BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H13 (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) 196 8e-51 SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) 188 4e-48 SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) 40 0.002 SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) 31 0.65 SB_26565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_14160| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_18790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 28 4.6 SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_1631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) 28 4.6 SB_3346| Best HMM Match : Spectrin (HMM E-Value=0.012) 28 6.1 SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 196 bits (479), Expect = 8e-51 Identities = 102/162 (62%), Positives = 118/162 (72%), Gaps = 4/162 (2%) Frame = +1 Query: 1 EKELREICYDVLCLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQ 180 E EL E+C VL LL+ LIP A + ESKVFYLKMKGDYYRY EVA + R VV+ + Sbjct: 66 ENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREVVQKAM 125 Query: 181 KAYQDAFEISKA--KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELD 354 KAY +A EI++ K+ PT PIRLGLALNFSVFYYEI+ +AC LAK+AFDDAIAELD Sbjct: 126 KAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAKKAFDDAIAELD 185 Query: 355 TLNEDSYKDSTLIMQLLRDNLTLWTSDTQG--DGDEPAEGGD 474 TL+ED YKDSTLIMQLLRDNLT+ Q + E AE GD Sbjct: 186 TLSEDQYKDSTLIMQLLRDNLTVVEKALQAYKEAKEAAETGD 227 Score = 138 bits (335), Expect = 2e-33 Identities = 69/103 (66%), Positives = 86/103 (83%), Gaps = 4/103 (3%) Frame = +1 Query: 160 SVVEDSQKAYQDAFEISKA---KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAF 330 +VVE + +AY++A E ++ K+ PT PIRLGLALNFSVF+YEI + ++AC+LAKQAF Sbjct: 207 TVVEKALQAYKEAKEAAETGDGKLAPTDPIRLGLALNFSVFHYEIQENQEEACKLAKQAF 266 Query: 331 DDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD-GDE 456 DDAIAELD+LNED YKDSTLIMQLLRDNLTLW+S+ Q D GD+ Sbjct: 267 DDAIAELDSLNEDQYKDSTLIMQLLRDNLTLWSSENQEDQGDD 309 >SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) Length = 248 Score = 188 bits (457), Expect = 4e-48 Identities = 91/153 (59%), Positives = 116/153 (75%), Gaps = 3/153 (1%) Frame = +1 Query: 7 ELREICYDVLCLLDKHLIPKAS---NPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDS 177 EL C +VL +L+ +L+ N E+KVFYLKM+GDY+RYL EVA G++R +E S Sbjct: 95 ELNGKCAEVLDILENYLLKDGQDDINTEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKS 154 Query: 178 QKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDT 357 ++AY+DA ++ P+HPIRLGLALNFSVFYYEI N P +AC+LAK+AFDDAIA LD Sbjct: 155 REAYKDA-SAKAEELSPSHPIRLGLALNFSVFYYEIENKPPEACKLAKEAFDDAIAVLDN 213 Query: 358 LNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 456 L ++SYKDSTLIMQLLRDNLTLWTS+ +G + Sbjct: 214 LKDESYKDSTLIMQLLRDNLTLWTSEQDQEGQD 246 >SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 65.3 bits (152), Expect = 3e-11 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = +1 Query: 1 EKELREICYDVLCLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGE 150 EKEL+++C +VL +L++ LIP A + E+KVFY K+KGDYYRYLAE + G+ Sbjct: 167 EKELKDLCKEVLGILER-LIPGAEDEENKVFYFKLKGDYYRYLAEFSHGQ 215 >SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) Length = 251 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +1 Query: 1 EKELREICYDVLCLLDKHLIPKASNPESKVFYLKM 105 E+EL+ IC ++L LLD LI + + ESKVFY K+ Sbjct: 91 EEELKTICGEILSLLDDSLIKNSQSEESKVFYNKI 125 >SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) Length = 979 Score = 31.1 bits (67), Expect = 0.65 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 331 DDAIAELDTLNEDSYKDSTLIMQL---LRDNLTLWTSDTQGDGDEPAEG 468 DD + D ++DS + + QL L+ + LW S TQGD D A G Sbjct: 850 DDDDFDTDEWSDDSDAEGSAAGQLKLCLKREILLWKSGTQGDADRRATG 898 >SB_26565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 343 RSHHRTPVWRADTPCLVNLISHNRRRRNLTPN 248 RSHH+ V PC +L+S RR+N+TP+ Sbjct: 194 RSHHQWSVPPGTDPC-TDLLSRGGRRQNMTPH 224 >SB_14160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 343 RSHHRTPVWRADTPCLVNLISHNRRRRNLTPN 248 RSHH+ V PC +L+S RR+N+TP+ Sbjct: 33 RSHHQWSVPPGTDPC-TDLLSRGGRRQNMTPH 63 >SB_18790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 306 VSARQTGVR*CDRGTRHT 359 V RQ+GVR C RG RHT Sbjct: 148 VMVRQSGVRYCSRGIRHT 165 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +1 Query: 139 ATGETRHS-VVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNS 294 A GETR + D+ +A +D KA+ Q + ALN S+F++E++NS Sbjct: 4020 ALGETRRKRSLVDTPEANED-----KAQHQVPDAEKCQFALNASLFFFEVINS 4067 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 412 NLTLWTSDTQGDGDEPAEGGDN*C 483 NL+L+T+D G+ P E GDN C Sbjct: 39 NLSLFTNDASGNLQPPREIGDNLC 62 >SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 412 NLTLWTSDTQGDGDEPAEGGDN*C 483 NL+L+T+D G+ P E GDN C Sbjct: 357 NLSLFTNDASGNLQPPREIGDNLC 380 >SB_1631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 412 NLTLWTSDTQGDGDEPAEGGDN*C 483 NL+L+T D+ G PAE G+N C Sbjct: 701 NLSLFTKDSSGQLQPPAEIGENLC 724 >SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) Length = 711 Score = 28.3 bits (60), Expect = 4.6 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -2 Query: 355 CRVPRSHHRTPVWRADTPCLVNL--ISHNRRRRN--LTPNPALL 236 CR+P S HR R ++ C N+ +S R R LTP P LL Sbjct: 651 CRLPSSRHRRRNVRGNSRCRGNVRALSSPMRARTLPLTPRPPLL 694 >SB_3346| Best HMM Match : Spectrin (HMM E-Value=0.012) Length = 983 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +1 Query: 274 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD 447 YY I + K Q FDD + +ED+ +D+T ++L+ T+D GD Sbjct: 505 YYNIPYNKPKKNDFKLQLFDDYKQAVTQASEDTLRDATTAIELMNAP----TTDVHGD 558 >SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 25 YDVLCLLDKHLIPKASNPESKVFYLKMKGDYY 120 YD ++ HL+P A +++ +K+ DYY Sbjct: 6 YDSNTVVSHHLLPSAQTRYIRIYPVKVNSDYY 37 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,744,432 Number of Sequences: 59808 Number of extensions: 290079 Number of successful extensions: 914 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -