BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H12 (438 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) 27 5.1 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 6.8 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 6.8 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 6.8 SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 27 8.9 SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) 27 8.9 SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) Length = 390 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -3 Query: 316 FKIAYLY--ETFTSHHGREGCRI-AWVD 242 F++A L E + SH GREGC+ WVD Sbjct: 75 FRLAQLLNEENWPSHLGREGCQFWIWVD 102 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 133 VIANPDPFFSQP-SNGPSGNYEPISTG 210 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 133 VIANPDPFFSQP-SNGPSGNYEPISTG 210 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 133 VIANPDPFFSQP-SNGPSGNYEPISTG 210 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 8.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 220 VDFNHPNYPPKRYD 261 VD NHPNY P+ Y+ Sbjct: 32 VDLNHPNYLPETYN 45 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 26.6 bits (56), Expect = 8.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 88 VDNSGVPSDGNSDHVVIANPDPFFSQ 165 VD+SGV D S +V A +P FSQ Sbjct: 161 VDSSGVAGDQRSSLLVSATLNPLFSQ 186 >SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 173 Score = 26.6 bits (56), Expect = 8.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 117 AVRWNTTIVHHVNSVCGSHGQY 52 A RW T H+ +CG HG+Y Sbjct: 55 ATRWTTN--HNCYHICGHHGRY 74 >SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 26.6 bits (56), Expect = 8.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 88 VDNSGVPSDGNSDHVVIANPDPFFSQ 165 VD+SGV D S +V A +P FSQ Sbjct: 90 VDSSGVAGDQRSSLLVSATLNPLFSQ 115 >SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 26.6 bits (56), Expect = 8.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 103 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 258 +P DGN IAN D PSN P ++ + A V+ +PP Y Sbjct: 87 IPEDGNGCAAYIANVD-----PSNKPGSHWLAVYFTYANVNGESFRFPPHAY 133 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 26.6 bits (56), Expect = 8.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 127 GHYCRPMEHHYCPPRELCLR 68 GH C+P CPP C+R Sbjct: 805 GHQCQPDTCDSCPPNSHCMR 824 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,816,307 Number of Sequences: 59808 Number of extensions: 264906 Number of successful extensions: 654 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -