BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H11 (682 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 1.1 01_06_0496 - 29795490-29796638,29796811-29796870,29798168-297983... 29 4.5 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 27.9 bits (59), Expect(2) = 1.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -2 Query: 441 NGISGNIGLNVDGNTERLVVESWLTNLEVVWVTS 340 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 1.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 309 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 217 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >01_06_0496 - 29795490-29796638,29796811-29796870,29798168-29798371, 29798739-29798984,29799375-29799464 Length = 582 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 523 LDWFTHKITPGQNKIVRNSXEFSLFXEDSLPXTDLMKL 636 +D F +T KI RNS +FS DS+P + L +L Sbjct: 278 VDSFQTNMTVEPEKIKRNSRKFSSSAADSVPDSQLSEL 315 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,643,843 Number of Sequences: 37544 Number of extensions: 319304 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -