BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H11 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 32 0.49 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) 29 4.6 SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 8.0 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.37 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 106 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 285 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 286 YSQ 294 Y Q Sbjct: 240 YGQ 242 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 31.9 bits (69), Expect = 0.49 Identities = 25/97 (25%), Positives = 42/97 (43%) Frame = +2 Query: 68 HLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*SLILKRNFISSALKS 247 +L HST T S L T T +++++T + TLTH +IT S I L Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 248 MMLSLRN*SHSLTIANLMPLTVYS*PKKRLRLVTHTT 358 + L+ +HS + + + + +TH+T Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITHST 121 Score = 29.5 bits (63), Expect = 2.6 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 2/90 (2%) Frame = +2 Query: 14 TRIINDLMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTH 187 T + L L+L ++ HL +ST T S LT T H +++Y T TLTH Sbjct: 46 TLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTH 99 Query: 188 SSIT*SLILKRNFISSALKSMMLSLRN*SH 277 S++T S + S + L+ N +H Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHSNLTH 129 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 146 SISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 313 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +2 Query: 35 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYITGLWVTLTHSSIT* 202 + L+ + + L H T T S LT T H H +++++T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 203 SLILKRNFISSALKSMMLSLRN*SHS 280 S + S L ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 47 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 139 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) Length = 306 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 58 LGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYNRIVGYINAF 189 +G + + F+P+ L F T+ D FY NR +G IN++ Sbjct: 1 MGVTLRRAKEKRFIPADLSFGITSFYDVYFYSPRNRSLGIINSY 44 >SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 499 ENWHKFYELDWFTHKITPGQNKIVRN 576 + WHK YELD F K + N I+RN Sbjct: 66 KEWHK-YELDKFMEKTSSYHNTILRN 90 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 223 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 315 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,848,121 Number of Sequences: 59808 Number of extensions: 387615 Number of successful extensions: 925 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -