BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H09 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 9e-24 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 68 4e-12 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 66 1e-11 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 58 4e-09 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 52 4e-07 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 48 5e-06 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 48 6e-06 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 46 1e-05 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 46 2e-05 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 40 0.001 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 38 0.006 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 36 0.015 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.079 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 34 0.079 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 32 0.24 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 31 0.56 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 31 0.56 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 30 0.97 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 29 2.2 SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_6406| Best HMM Match : Mis12 (HMM E-Value=0.49) 29 3.0 SB_38536| Best HMM Match : 7tm_1 (HMM E-Value=4.7e-23) 28 3.9 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) 28 3.9 SB_2864| Best HMM Match : ATP-synt_8 (HMM E-Value=1.2) 28 5.2 SB_57955| Best HMM Match : Ribosomal_L41 (HMM E-Value=5) 28 5.2 SB_8599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 27 9.1 SB_18731| Best HMM Match : DUF1309 (HMM E-Value=2) 27 9.1 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 106 bits (255), Expect = 9e-24 Identities = 61/167 (36%), Positives = 81/167 (48%), Gaps = 1/167 (0%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPAAGDKFKEISYAYEVLSDPKKRQTYDKYXXXXXXXXXXXXXFP 193 KK + + HPDKNP GD+FK+IS AYEVLSD KKR+ YD+ F Sbjct: 82 KKSYRKLALKYHPDKNPDEGDRFKQISQAYEVLSDEKKRKIYDEGGEDAIKGGGEGGGFH 141 Query: 194 AD-DLFGHFFGDIFXXXXXXXXXXXXXXEDTMHPLKVTLEDMYMGKTTKLQLSKNXXXXX 370 + D+F FFG +D +H L+VTLE++Y G T +L L KN Sbjct: 142 SPMDIFDMFFG-----TGRAAHQGERRGKDMVHQLRVTLEELYNGATRQLALQKNVICSK 196 Query: 371 XXXXXXXXXSAVTCEYCHGQGIRVSYQQIAPQMTRQFQQRCPVCEGQ 511 +C+ CHG G+ V +IAP M +Q Q C C G+ Sbjct: 197 CDGRGGKEGCVESCQTCHGSGMYVRINRIAPGMVQQIQTVCRDCGGK 243 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 68.1 bits (159), Expect = 4e-12 Identities = 30/70 (42%), Positives = 42/70 (60%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPAAGDKFKEISYAYEVLSDPKKRQTYDKYXXXXXXXXXXXXXFP 193 KK +K +HPDKNP G+KFK+I++AYE+LSDP+KR+ YD+Y Sbjct: 22 KKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELYDRYGEKGLREGAGGGA-G 80 Query: 194 ADDLFGHFFG 223 +D+ H FG Sbjct: 81 FEDILSHIFG 90 Score = 36.3 bits (80), Expect = 0.015 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 410 CEYCHGQGIRVSYQQIAPQMTRQFQQRCPVCEGQ 511 C C G+G++V+ + I P M +Q Q C C G+ Sbjct: 138 CAGCKGRGVKVTIKPIGPGMVQQMQSMCHDCSGE 171 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 66.5 bits (155), Expect = 1e-11 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPAAGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK +K +HPDKNP G+KFK+I++AYE+LSDP+KR+ YD+Y Sbjct: 22 KKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELYDRY 66 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 58.0 bits (134), Expect = 4e-09 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKN--PAAGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK + + HPDKN P A +KFKEIS AYEVLSDPKK++ YD+Y Sbjct: 21 KKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEIYDQY 67 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 54.8 bits (126), Expect = 4e-08 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKN--PAAGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK + + HPDKN P A +KFKEI+ AYEVLSDP+KR+ +D+Y Sbjct: 21 KKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIFDQY 67 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 51.6 bits (118), Expect = 4e-07 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPA----AGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK + R HPDKNP A +KFK++S AYEVLSD +KR YDKY Sbjct: 21 KKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRDIYDKY 69 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 50.8 bits (116), Expect = 6e-07 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 6/76 (7%) Frame = +2 Query: 14 KKKLS*TSKRIHPD--KNPAAGDKFKEISYAYEVLSDPKKRQTYDKYXXXXXXXX----X 175 KK +K+ HPD K+ +A +KF+E+S AYEVLSD KR+ YD + Sbjct: 76 KKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSDDGKRKAYDSFGQTDFSGAQGGPF 135 Query: 176 XXXXFPADDLFGHFFG 223 F A+D+ FFG Sbjct: 136 GGAGFDAEDILKSFFG 151 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +2 Query: 41 RIHPDKNPAAGDKFKEISYAYEVLSDPKKRQTYDK 145 + HPDKN + FKE+S AYEVL DP++R+ +DK Sbjct: 30 KYHPDKNAGTEENFKEVSEAYEVLCDPQQRERFDK 64 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 48.0 bits (109), Expect = 5e-06 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKN--PAAGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK+ S + HPDKN P+A KF++ + AY+VLSDPKKR Y+++ Sbjct: 21 KKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQF 67 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 47.6 bits (108), Expect = 6e-06 Identities = 21/36 (58%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = +2 Query: 47 HPDKNPAAG--DKFKEISYAYEVLSDPKKRQTYDKY 148 HPDKN +G +KFKEIS AY+VL+DP++R +D Y Sbjct: 32 HPDKNKNSGAEEKFKEISEAYKVLTDPRQRDIFDMY 67 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPA--AGDKFKEISYAYEVLSDPKKRQTYDKY 148 KK + + HPDKN A +KF+E++ AYEVLSD KR+ YD++ Sbjct: 43 KKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVLSDENKRRQYDQF 89 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 45.6 bits (103), Expect = 2e-05 Identities = 31/99 (31%), Positives = 42/99 (42%), Gaps = 4/99 (4%) Frame = +2 Query: 41 RIHPDKN---PAAGDKFKEISYAYEVLSDPKKRQTYD-KYXXXXXXXXXXXXXFPADDLF 208 ++HPDKN P A +KF +I AYEVL+D +R+ YD + P F Sbjct: 51 KLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRKIYDQRGEEGLKNAGHRDHSDPFSSFF 110 Query: 209 GHFFGDIFXXXXXXXXXXXXXXEDTMHPLKVTLEDMYMG 325 G F D L+VTLE++Y G Sbjct: 111 GGFGFHFDGHNGHSHSQQVPRGSDLTVDLEVTLEELYNG 149 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 8/78 (10%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPAAGDK--------FKEISYAYEVLSDPKKRQTYDKYXXXXXXX 169 KK + + HPD++ A D+ FKE++ AY +LSDPKK++ YD Sbjct: 176 KKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYD--SGQDLEE 233 Query: 170 XXXXXXFPADDLFGHFFG 223 F + +F FFG Sbjct: 234 GYGMDDFDPNSIFQAFFG 251 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 8/78 (10%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPAAGDK--------FKEISYAYEVLSDPKKRQTYDKYXXXXXXX 169 KK + + HPD++ A D+ FKE++ AY +LSDPKK++ YD Sbjct: 176 KKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYD--SGQDLEE 233 Query: 170 XXXXXXFPADDLFGHFFG 223 F + +F FFG Sbjct: 234 GYGMDDFDPNSIFQAFFG 251 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Frame = +2 Query: 47 HPDKNPAAGDK----FKEISYAYEVLSDPKKRQTYDKY 148 HPDKN ++ F+EI AY+VLSDP++R YDK+ Sbjct: 32 HPDKNLDNAEESTRVFREIQQAYDVLSDPQERAFYDKH 69 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/39 (56%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 14 KKKLS*TSKRIHPDKNPA----AGDKFKEISYAYEVLSD 118 KK + + HPDKNP A KFKEIS AYEVLSD Sbjct: 20 KKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 36.3 bits (80), Expect = 0.015 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +2 Query: 41 RIHPDKNP---AAGDKFKEISYAYEVLSDPKKRQTYD 142 + HPDKNP A + F ++S A EVL+DPK R ++ Sbjct: 33 KCHPDKNPDNPKASELFHKLSKALEVLTDPKARAAFN 69 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 33.9 bits (74), Expect = 0.079 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 6/70 (8%) Frame = +2 Query: 35 SKRIHPDKNPAAGDKFK---EISYAYEVLSDPKKRQTYDKYXXXXXXXX---XXXXXFPA 196 +K HPD NP D K ++S AY LS +RQ YD + + Sbjct: 32 TKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQYDARLNSSFASTYRPATASTYSS 91 Query: 197 DDLFGHFFGD 226 FGH G+ Sbjct: 92 SSPFGHRDGE 101 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 33.9 bits (74), Expect = 0.079 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 6/70 (8%) Frame = +2 Query: 35 SKRIHPDKNPAAGDKFK---EISYAYEVLSDPKKRQTYDKYXXXXXXXX---XXXXXFPA 196 +K HPD NP D K ++S AY LS +RQ YD + + Sbjct: 93 TKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQYDARLNSSFASTYRPATASTYSS 152 Query: 197 DDLFGHFFGD 226 FGH G+ Sbjct: 153 SSPFGHRDGE 162 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 32.3 bits (70), Expect = 0.24 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 35 SKRIHPDKNPAAGDKFKEISYAYEVLSDPKK 127 SK+ HPDK KF I+ AYE +SD K Sbjct: 1272 SKKYHPDKETGDPRKFMRIAKAYEAVSDFNK 1302 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = +2 Query: 35 SKRIHPDKNPAAGDK---FKEISYAYEVLSDPKKRQTYDK 145 S + HPD++ + K F+EI+ AY VL + + R+ YD+ Sbjct: 96 SMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQYDR 135 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 31.1 bits (67), Expect = 0.56 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 35 SKRIHPDKNPA--AGDKFKEISYAYEVLSDPKKRQTYD 142 S ++HPD+N A KF+++ EVL D KR+ YD Sbjct: 2507 SLQLHPDRNKEDDAELKFRKLVAVAEVLKDEDKRKRYD 2544 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = +2 Query: 35 SKRIHPDKNPAAGDK---FKEISYAYEVLSDPKKRQTYDK 145 S + HPD++ + K F+EI+ AY VL + + R+ YD+ Sbjct: 96 SMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQYDR 135 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = +2 Query: 35 SKRIHPDK-----NPAAGDKFKEISYAYEVLSDPKKRQTYDK 145 S ++HPD+ A KF+ +S +Y +LSD +KR YD+ Sbjct: 39 SLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRAIYDE 80 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 30.3 bits (65), Expect = 0.97 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 53 DKNPAAGDKFKEISYAYEVLSDPKKRQTYD 142 D A KF+ I+ AYE L DP++R YD Sbjct: 74 DDKENAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 47 HPDKNPAAGDKFKEISYAYEVLSDPKKRQTYD 142 HPDKN ++ + I AY L D + R Y+ Sbjct: 167 HPDKNGGDAEQARNIIMAYSCLEDDETRARYN 198 >SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1319 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 3 ESEIKRSYHKLAKESTLIKILQLETNSKKLATLTRCC 113 +S ++ S+ ++ + L L N++KLAT + CC Sbjct: 462 QSYLRESWQTCVNQNKKVPALLLRDNNRKLATSSMCC 498 >SB_6406| Best HMM Match : Mis12 (HMM E-Value=0.49) Length = 714 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +3 Query: 180 VEASLQMTCLDISLVIYLAWGVEAEPAGQLVVKTQCTL*KLLWKICIWVKQP 335 + +SL +TC I+ I+LA P V L ++ ++ +W+ +P Sbjct: 593 MSSSLGVTCSPITWTIWLACRTRGMPVYTAFVMQHSKLCSMIRRLAVWIVEP 644 >SB_38536| Best HMM Match : 7tm_1 (HMM E-Value=4.7e-23) Length = 389 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 313 YVYG*NNQTTV-K*KCYLWSL*RSWRKTGISCDL*ILSWARY 435 Y+YG ++ K C++W+L SW T +L ++W RY Sbjct: 36 YLYGYDSAWIFGKAMCHMWTLASSWFATASIFNLCAVTWDRY 77 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 5/37 (13%) Frame = +2 Query: 47 HPDKNPAAGDK-----FKEISYAYEVLSDPKKRQTYD 142 HPD K F +I+ A EVL+DP+KR YD Sbjct: 236 HPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEKRAKYD 272 >SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) Length = 1099 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = -2 Query: 254 LCFHPPCQIYHQRNVQTSHLQGSLH----LDHLPEVLSNR---IYHK-SVVF 123 + +HPP +IYH+ ++ +H + H P V+ +R +YH+ S+VF Sbjct: 306 IIYHPPPEIYHRPDIVVHRAPIMIHRAPIIYHQPPVVVHRPAIVYHQPSIVF 357 >SB_2864| Best HMM Match : ATP-synt_8 (HMM E-Value=1.2) Length = 250 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +3 Query: 3 ESEIKRSYHKLAKESTLIKILQLETNSKKLATLTRCCPILK-----NDRLMINTV 152 +SE+ R + K S LI++L L + + RCC +L+ DR +I T+ Sbjct: 156 KSEVLRLRIVIKKPSRLIEVLALALTHRPPQSPRRCCTVLREVQCPQDRFVIATI 210 >SB_57955| Best HMM Match : Ribosomal_L41 (HMM E-Value=5) Length = 404 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +3 Query: 180 VEASLQMTCLDISLVIYLAWGVEAEPAGQLVVKTQCTL*KLLWKICIWVKQP 335 + +SL +TC I+ I+LA P V L ++ ++ +W+ +P Sbjct: 282 MSSSLGVTCSPITWTIWLACRTREMPVYTAFVMQHSKLWSMVRRLAVWIVEP 333 >SB_8599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -2 Query: 281 CLHHELARGLCFHPPCQIYHQRNVQTSHLQGSLHLDH 171 C H ++A L PC H T L+ H DH Sbjct: 706 CEHLDIANTLLLRTPCYCEHPAIANTLPLRSPCHCDH 742 >SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -1 Query: 387 PPTPLQGPQ-ITFLLNCSLVVLPIYISSKVTF 295 PP PL ITFLLN L P+ SS +TF Sbjct: 482 PPQPLPSSSAITFLLNHYLPPQPLPSSSTITF 513 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -1 Query: 387 PPTPLQ-GPQITFLLNCSLVVLPIYISSKVTF 295 PP PL ITFLLN L P+ SS +TF Sbjct: 520 PPQPLPFSSAITFLLNHYLPPQPLPSSSTITF 551 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 230 IYHQRNVQTSHLQGSLHLDHLPEVLSNRI 144 IYH R++ T +L SL H+ + SNRI Sbjct: 49 IYHYRSIITLYLFSSLTDGHVRSMTSNRI 77 >SB_18731| Best HMM Match : DUF1309 (HMM E-Value=2) Length = 356 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = -2 Query: 254 LCFHPPCQIYHQRNVQTSHLQGSLH----LDHLPEVLSNR---IYHK-SVVF 123 + +HPP ++YH+ ++ LH + H P V+ +R IYH+ +VF Sbjct: 157 IIYHPPPEVYHRPDIVVHRAPIMLHRPAIIYHQPPVVVHRPAIIYHQPPIVF 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,987,957 Number of Sequences: 59808 Number of extensions: 279819 Number of successful extensions: 662 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -