BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H05 (393 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 2.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 2.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 2.9 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 3.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 3.8 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 20 8.8 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 2.2 Identities = 15/59 (25%), Positives = 27/59 (45%) Frame = -1 Query: 189 IANYTTHISPSLVPSQM*QGASLSPYRAQIPNSGMILSRKNPISLDPTRGSNPRPQNGS 13 +A++ +H+S +L S + P A + +P P RGS+P Q+G+ Sbjct: 283 LASHHSHLSSALGRSAC-HSPGVYPSTAGFLPPSYHPHQHHPSQYHPHRGSSPHHQHGN 340 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 2.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 9 YDCRSEVSGSIPG 47 Y+C +GSIPG Sbjct: 62 YECEGRSAGSIPG 74 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 2.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 9 YDCRSEVSGSIPG 47 Y+C +GSIPG Sbjct: 62 YECEGRSAGSIPG 74 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 3.8 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +3 Query: 273 ETYLYNGRH 299 +TY YNG+H Sbjct: 121 DTYFYNGKH 129 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 3.8 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +3 Query: 273 ETYLYNGRH 299 +TY YNG+H Sbjct: 89 DTYFYNGKH 97 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 20.2 bits (40), Expect = 8.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -1 Query: 123 LSPYRAQIPNSGMILSRKNPISLDPTRGS 37 LSP+ PN IL PI GS Sbjct: 47 LSPFNIDTPNRQKILKDGFPIKCGTFLGS 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,205 Number of Sequences: 438 Number of extensions: 2276 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -