BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H02 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155,332... 28 4.4 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 28 5.9 02_05_0008 + 24934917-24935229,24936387-24936608,24936876-249375... 28 5.9 01_06_0693 - 31280108-31281271 28 5.9 >06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155, 3325237-3325317,3328173-3328820 Length = 819 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 496 TVLLRSSXRCVDCSCPAFERMG 431 TVLL +S + C C FERMG Sbjct: 388 TVLLDTSTMEISCGCRKFERMG 409 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 43 RTKMQDGILHDAKAINYGIVKEEEQYVYYANYSNTFLYNNEE--QRLTYLTEDIGFN 207 R Q G + D I YGI +++Y+ S+ + NE+ T +ED+G N Sbjct: 284 RIHRQKGHVEDHLYI-YGIASTYTRWIYHGEQSDAGINENEDHLDEHTSFSEDVGIN 339 >02_05_0008 + 24934917-24935229,24936387-24936608,24936876-24937591, 24937646-24937728,24938448-24938514,24938833-24939228, 24939276-24939318,24939380-24939474,24940287-24940314, 24940636-24940754 Length = 693 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 166 EQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLKH 279 E+ + + IG Y Y + PF GNLKH Sbjct: 281 EESIHFFMRSIGLREYSRYLCFNFPFTHEKSLLGNLKH 318 >01_06_0693 - 31280108-31281271 Length = 387 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = +1 Query: 10 FVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVYYANYSNTF-----LYNNEEQR 174 ++ MDT+ ++R +++G+ D +A+N +VK Q ++ + F +Y E Sbjct: 196 YMYMDTVSALFRQMLEEGVPPDTRALNV-LVKGYAQSLHLNDALRVFHQMRPVYGCEPDA 254 Query: 175 LTY 183 LTY Sbjct: 255 LTY 257 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,914,745 Number of Sequences: 37544 Number of extensions: 264208 Number of successful extensions: 657 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -