BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H02 (560 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical pr... 31 0.57 AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 27 7.0 Z93380-3|CAB07600.1| 339|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical protein R13H4.2a protein. Length = 225 Score = 31.1 bits (67), Expect = 0.57 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 184 LTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRY 330 L +D ++ YYY+ + ++ S RY + Y+N Y TRY Sbjct: 71 LYDDYWYDKYYYFSPLYRSTYYPSRRYSYSDYLPNPYYWNNYGSYWTRY 119 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 232 HLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYY 333 HLPF + + + H R EI+YN + + Y+ Sbjct: 264 HLPFQYELVDHDKMYHHRTEIWYNNDMSIGSSYH 297 >Z93380-3|CAB07600.1| 339|Caenorhabditis elegans Hypothetical protein F28C12.4 protein. Length = 339 Score = 27.1 bits (57), Expect = 9.2 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 4/94 (4%) Frame = +1 Query: 145 TFLYNNEEQRLTYLTEDIGFNSYYY----YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQ 312 +F+Y++E RL + D Y+Y YF ++ F + +R + + + Y ++ Sbjct: 92 SFVYSSEPCRLPFHFTDCEVELYFYYLTNYFSTYSVFSLTFDRL--ISYFFPKCYISYPY 149 Query: 313 QLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPL 414 Q++ +L LG+ F Y K GY P+ Sbjct: 150 QVSISLLIIQLVFTLGTY-YFGLYGVPKLGYVPI 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,483,718 Number of Sequences: 27780 Number of extensions: 254915 Number of successful extensions: 585 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1155524042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -