BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H01 (537 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb... 28 1.0 SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modifica... 27 1.8 SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosacch... 27 2.3 SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces p... 26 3.1 SPAC2F3.08 |sut1||alpha-glucoside transporter |Schizosaccharomyc... 25 5.4 SPBC31F10.05 |mug37||sequence orphan|Schizosaccharomyces pombe|c... 25 5.4 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 25 7.2 SPBC1703.05 |||protein kinase, RIO family|Schizosaccharomyces po... 25 9.5 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 25 9.5 SPBC12D12.06 |srb11||cyclin CycC|Schizosaccharomyces pombe|chr 2... 25 9.5 >SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 1254 Score = 27.9 bits (59), Expect = 1.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 319 TKHRYQVKGKHQLLALVEHHDKQLR 393 T +YQ + K++L AL+E + KQLR Sbjct: 842 TSQKYQSELKNELYALLEQYKKQLR 866 >SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modification enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 666 Score = 27.1 bits (57), Expect = 1.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 209 EPSRMDPNSEWLPNSI 256 EP +DPNS W PN + Sbjct: 315 EPEGLDPNSWWYPNGL 330 >SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 26.6 bits (56), Expect = 2.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 198 ICSIRSCQ*INSRCFLSAFCILYSC 124 + SIR+C +CF AFC + C Sbjct: 225 LVSIRTCMLNAKKCFTDAFCEILRC 249 >SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 3|||Manual Length = 509 Score = 26.2 bits (55), Expect = 3.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -1 Query: 279 NYNCCPKGIEFGNHSELGSIRDGSRPEICSIRS 181 +YN P + FGNH +LG D SR E+ I S Sbjct: 287 DYNV-PFAVNFGNHDDLG---DLSREELAKILS 315 >SPAC2F3.08 |sut1||alpha-glucoside transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 553 Score = 25.4 bits (53), Expect = 5.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 187 PFLSINKFALFSICLLYLIFMQVA 116 P L ++ LF +C+L IF+Q + Sbjct: 425 PILWLSSHVLFGVCMLSTIFLQTS 448 >SPBC31F10.05 |mug37||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 25.4 bits (53), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 187 DGTNLRTGTVPNGSQFRMVTEFNT 258 +G +T TVP QF V EFN+ Sbjct: 68 EGEKTKTETVPTRKQFPKVGEFNS 91 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 399 AENCISTPEYNPVCGSDHKTYKNQGRLFVPNCDQVIGQ 512 +EN + +NP+ GS H +++ L V D +G+ Sbjct: 243 SENSFNDDGFNPLVGSQHDGVESRPELNVGTIDFKVGK 280 >SPBC1703.05 |||protein kinase, RIO family|Schizosaccharomyces pombe|chr 2|||Manual Length = 336 Score = 24.6 bits (51), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 141 KRQIENNANLFIDKNGWNKSQ 203 K + ENN ++ I+ +G+NK Q Sbjct: 283 KMEKENNLDIMIEASGFNKKQ 303 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 24.6 bits (51), Expect = 9.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +2 Query: 107 SQSGDLHEYKIQKADRKQREFIY*QERMEQISGREPSRMDPNSE 238 +Q+ +H+ + ++ IY +ER+E++ R+ NSE Sbjct: 32 TQNQTVHQQLHSNIEESKKSIIYLEERLEKLKLRKNGVRKSNSE 75 >SPBC12D12.06 |srb11||cyclin CycC|Schizosaccharomyces pombe|chr 2|||Manual Length = 228 Score = 24.6 bits (51), Expect = 9.5 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -2 Query: 311 LHLIRKNEGYKIIIVVQRVLN 249 L LI+ + +K+I+ VQR+++ Sbjct: 200 LDLIKSTDAFKVILCVQRIIS 220 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,347,757 Number of Sequences: 5004 Number of extensions: 49866 Number of successful extensions: 123 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -