BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H01 (537 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 3.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 4.6 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 21 8.0 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.0 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 3.5 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDHKTYKNQGRLFVPNC 494 C C + PVC S+ K Y N L C Sbjct: 106 CMRKC--PRRHRPVCASNGKIYANHCELHRAAC 136 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 4.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +3 Query: 408 CISTPEYNPVCGSDH 452 C+ Y PVC DH Sbjct: 149 CVPFTTYTPVCEYDH 163 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 4.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 165 NLFIDKNGWNKSQDGNRPEW 224 N+F+DK G++ N +W Sbjct: 198 NIFLDKKGFHMDGYTNNSKW 217 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 150 IENNANLFIDKNGWNK 197 I A +F+D+NG NK Sbjct: 84 IREIAEIFLDENGVNK 99 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 194 VPSVLVNK*IRVVFYLP 144 +P +L+N +VFY+P Sbjct: 222 LPCILINSVALLVFYVP 238 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,657 Number of Sequences: 438 Number of extensions: 3929 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -