BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G23 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38975| Best HMM Match : Serpin (HMM E-Value=0) 37 0.010 SB_54964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_54546| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) 29 2.0 SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6) 29 2.0 SB_21974| Best HMM Match : Ail_Lom (HMM E-Value=4.4) 29 2.0 SB_39988| Best HMM Match : NAD_kinase (HMM E-Value=1.8) 27 8.2 SB_37386| Best HMM Match : DUF164 (HMM E-Value=0.46) 27 8.2 >SB_38975| Best HMM Match : Serpin (HMM E-Value=0) Length = 380 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +3 Query: 303 NLKSIQGITLNIANKVYLKEGPYELHSELKEDAVKVFDASFEKLNFNDGAASAA-AINKW 479 N + G + +AN+++ + G +E+ E K+ + + F A +++ + A +N+W Sbjct: 78 NASNSDGNQILMANRLFAQMG-FEILEEFKKASKESFSAEMALVDYVKNSNGARDTVNRW 136 Query: 480 VESKTNDRIQ 509 VE KT D+I+ Sbjct: 137 VEQKTKDKIK 146 >SB_54964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 357 KEGPYELHSELKEDAVKVFDASFEKL 434 ++GP+ + L+ED VK++D F+K+ Sbjct: 19 EQGPFHVFLNLQEDVVKIYDFLFKKV 44 >SB_54546| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) Length = 848 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 357 KEGPYELHSELKEDAVKVFDASFEKL 434 ++GP+ + L+ED VK++D F+K+ Sbjct: 19 EQGPFHVFLNLQEDVVKIYDFLFKKV 44 >SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6) Length = 555 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 357 KEGPYELHSELKEDAVKVFDASFEKL 434 ++GP+ + L+ED VK++D F+K+ Sbjct: 315 EQGPFHVFLNLQEDVVKIYDFLFKKV 340 >SB_21974| Best HMM Match : Ail_Lom (HMM E-Value=4.4) Length = 463 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 357 KEGPYELHSELKEDAVKVFDASFEKL 434 ++GP+ + L+ED VK++D F+K+ Sbjct: 223 EQGPFHVFLNLQEDVVKIYDFLFKKV 248 >SB_39988| Best HMM Match : NAD_kinase (HMM E-Value=1.8) Length = 581 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 12 DIFLLIVTVSLFLSLPVKSSELTMDAKAISSAVAKFSAKFLNELDKSQNVVSSPLSA 182 DI ++I+ + ++ +SS L DA +SS K + ++LN DK+ N+ SA Sbjct: 259 DIVIIIIIIITTITNHHRSSPL-FDAIELSSEPVKRAYQYLNGRDKNMNLDHFKFSA 314 >SB_37386| Best HMM Match : DUF164 (HMM E-Value=0.46) Length = 189 Score = 27.5 bits (58), Expect = 8.2 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = +3 Query: 279 SSFTSITSNLKSIQGITLNIANKVYLKEGPYELHSELKEDAVKVFDASFEKLNFNDGAAS 458 + +T L + + + + + KEG Y+ + EDA K ++ +KL D AS Sbjct: 21 TEIVKLTEKLDTAETSLVFMKKDLARKEGIYKAQQDELEDAEKQLASTRKKL--QDMKAS 78 Query: 459 AAAINKWVESKTND 500 A+N+ E ND Sbjct: 79 YEAVNEENEKLKND 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,774,509 Number of Sequences: 59808 Number of extensions: 230941 Number of successful extensions: 486 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -