BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G18 (461 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 3.2 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 3.2 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 5.6 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 5.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 20 9.7 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 8 LTGLPRVLNSLSDLRVEMNNLRERLVDVRLPKF 106 LT + VLN LSD+ + ++N+ + ++ K+ Sbjct: 130 LTDIKLVLNILSDVTLWLSNVNSLTLTLKRKKW 162 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 8 LTGLPRVLNSLSDLRVEMNNLRERLVDVRLPKF 106 LT + VLN LSD+ + ++N+ + ++ K+ Sbjct: 56 LTDIKLVLNILSDVTLWLSNVNSLTLTLKRKKW 88 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 185 FPGLARGQLVREALRLSHV 241 F LARG L++ LSHV Sbjct: 108 FTFLARGTLIKSFDMLSHV 126 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 185 FPGLARGQLVREALRLSHV 241 F LARG L++ LSHV Sbjct: 108 FTFLARGTLIKSFDMLSHV 126 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 324 EKIPTSSTRWWPIDRS 371 EK+ + T W P D+S Sbjct: 566 EKLGVALTNWHPSDKS 581 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,073 Number of Sequences: 336 Number of extensions: 2006 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -