BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G17 (569 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0234 + 15187065-15188241,15188316-15188494 44 6e-05 04_03_0649 - 18402976-18403220,18403305-18404499 38 0.006 08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280,159... 30 1.1 10_08_0009 + 14075929-14076789 29 2.6 03_02_0517 + 9054816-9055655 29 3.4 08_02_0992 + 23380855-23381195,23382464-23382506,23383306-233833... 28 4.6 06_01_0008 + 141405-142421 28 6.0 02_05_1001 + 33423562-33424098 28 6.0 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 27 8.0 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 44.4 bits (100), Expect = 6e-05 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 349 LRVFLTVGGDDDTEDPQK--YNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 513 ++ L++G D+ ED ++ + R AF NS++ LA GFDG+DL+W+ P Sbjct: 109 VKTILSIGTDEFREDVSNAAFSRMASEKNLRRAFINSSIELARANGFDGLDLAWRFP 165 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +1 Query: 391 DPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 513 DP + + P +R AF +A+ +A + GFDG+D++W+ P Sbjct: 131 DPA-FAAMAADPASRAAFIGAAVKVARENGFDGLDVAWRFP 170 >08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280, 1595596-1595766,1595902-1596007,1596339-1596545, 1596638-1596802 Length = 410 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 445 TNSALLLAEQYGFDGIDLSWQLPKRKPKKIRSSIGSFW 558 T +L+ E + FD L+W + R P +I++++ +W Sbjct: 339 TKKMILVGEVFRFDLDTLTWSVIGRMPFRIKTALAGYW 376 >10_08_0009 + 14075929-14076789 Length = 286 Score = 29.1 bits (62), Expect = 2.6 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 4/76 (5%) Frame = +1 Query: 292 DRAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALL--- 462 D A+ + A+ K P L V L +GGD T N + A+ +A Sbjct: 62 DTANLSPAAVAAAKAAHPNLSVILALGGD--TVQNTGVNATFAPTSSVDAWVRNAADSVS 119 Query: 463 -LAEQYGFDGIDLSWQ 507 L + YG DG+D+ ++ Sbjct: 120 GLIDAYGLDGVDVDYE 135 >03_02_0517 + 9054816-9055655 Length = 279 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 158 ENLKHVCCLRTWSLLFRSAPICCTNLPASKLHHIKWFHSMRIWTL 292 +++ H C+ W L S P+C LPA+ + + IW L Sbjct: 154 KHVYHQDCILPWLSLRNSCPVCRRELPAAAAPESEADAGLTIWRL 198 >08_02_0992 + 23380855-23381195,23382464-23382506,23383306-23383371, 23384228-23384428,23384450-23384707,23384798-23385013, 23385148-23385321,23386151-23386312,23386594-23386635 Length = 500 Score = 28.3 bits (60), Expect = 4.6 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +1 Query: 223 LYKSAGIQAPPYQMVSLNENLDIDRAHANYR-AITNLKRQFPQLRVFLTVGGDDDTE--D 393 L + Q Y+++S+NE D A YR AI N Q ++ V + E Sbjct: 3 LSSNISTQKTHYEVLSVNEGATYDEVRAGYRAAILNAHPDKSQAKLDSLVSSVEHGEFFS 62 Query: 394 PQKYNLLLESPQARTAF 444 QK +L P++RT + Sbjct: 63 VQKAWEVLRDPKSRTEY 79 >06_01_0008 + 141405-142421 Length = 338 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 170 HVCCLRTWSLLFRSAPICCTNLPASKLHH 256 H C+ W L S P+C LP HH Sbjct: 225 HKDCILPWLDLHSSCPVCRFELPTDDPHH 253 >02_05_1001 + 33423562-33424098 Length = 178 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 254 GGAWMPADLYSRWVQNERA 198 G W PAD+ + WV ERA Sbjct: 98 GVGWAPADVVAAWVSRERA 116 >04_04_1630 - 34896021-34896143,34896329-34896403,34896500-34896556, 34897176-34897352,34897426-34897492,34898043-34898101, 34898188-34898241,34898455-34898604,34898709-34898918, 34898980-34899039,34899399-34899527,34899616-34899720, 34899935-34900024,34900630-34900695,34901047-34901115, 34901348-34901467,34901572-34901634,34901681-34901817, 34902070-34902160,34902298-34902463,34902700-34904172, 34905666-34905940,34906322-34906819,34906996-34907145, 34907840-34907911,34908006-34908266,34908478-34908558, 34908745-34908996,34909323-34909382,34909602-34909853, 34910385-34910549,34910589-34910849,34911267-34912307, 34913398-34913457,34914055-34914165,34914448-34914534, 34915227-34915300,34915397-34915490,34915644-34915689, 34916397-34916521 Length = 2501 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 283 LDIDRAHANYRAITNLKRQFPQLRVFL 363 + +D ANYRA+ L + FP ++ F+ Sbjct: 2373 ITLDTPGANYRAVWALSKYFPNVKTFV 2399 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,599,727 Number of Sequences: 37544 Number of extensions: 288164 Number of successful extensions: 839 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -