BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G16 (573 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52550.1 68418.m06525 expressed protein 30 0.95 At5g50200.3 68418.m06216 expressed protein similar to unknown pr... 29 1.7 At5g50200.2 68418.m06218 expressed protein similar to unknown pr... 29 1.7 At5g50200.1 68418.m06217 expressed protein similar to unknown pr... 29 1.7 At2g02120.1 68415.m00148 plant defensin-fusion protein, putative... 29 1.7 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 29 2.9 At5g06580.1 68418.m00743 FAD linked oxidase family protein simil... 27 6.7 At4g04920.1 68417.m00715 expressed protein 27 6.7 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 30.3 bits (65), Expect = 0.95 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -1 Query: 195 DSCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHH 40 + C D R PWD+ + SGG++ H RC+ Y V +++ Sbjct: 250 EDCDDSYRNTLNQETGFKPWDYT-TKINLFSGGINRFFPHQRCSSYAVHDNN 300 >At5g50200.3 68418.m06216 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 379 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESAPG 525 HK+ AK D+ S WT +D+ F V++YAV +G E A G Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVAYG 154 >At5g50200.2 68418.m06218 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 379 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESAPG 525 HK+ AK D+ S WT +D+ F V++YAV +G E A G Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVAYG 154 >At5g50200.1 68418.m06217 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 379 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESAPG 525 HK+ AK D+ S WT +D+ F V++YAV +G E A G Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVAYG 154 >At2g02120.1 68415.m00148 plant defensin-fusion protein, putative (PDF2.1) plant defensin protein family member, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be); contains a gamma-thionin family signature (PDOC00725) Length = 77 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -3 Query: 313 SKCRRSCHPDELPGG-CRPFCLRVFC 239 + C CH + PGG CR F R FC Sbjct: 48 TNCENVCHNEGFPGGDCRGFRRRCFC 73 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 103 GAPPSACF-DMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTP 249 G PS C D I A + +P + T + GH++ I+GKTP Sbjct: 447 GWSPSKCQEDKIEPPQASPGSTSSPNPLPTDEQQSRGGHAVSPAIAGKTP 496 >At5g06580.1 68418.m00743 FAD linked oxidase family protein similar to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 567 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 350 LRGCEKV-SSGLTVQVPTILSP*RASRRMPAILSSGVLPL 234 LR C ++ S+ + T+LSP + RR+P SS + PL Sbjct: 17 LRPCRQLHSTPKSTGDVTVLSPVKGRRRLPTCWSSSLFPL 56 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.5 bits (58), Expect = 6.7 Identities = 24/107 (22%), Positives = 42/107 (39%), Gaps = 3/107 (2%) Frame = +1 Query: 199 SVKAGHSIDVVISGKTPEDKMAGILLEARQGDKIVGTWTVSPDDTFSQPLNCGEPNNAVT 378 ++++ I VV+ K E + G + + VSP F L +PN+ + Sbjct: 43 TIESTDPILVVVEEKLLEKSVDGEKEDDNSSSSNMEIDPVSPATVFCVKLK--QPNSNLL 100 Query: 379 HKMHAKELDRQTVSYPWTAPKD---LEGDVVFKVTIVKSYAVFWVGI 510 HKM EL R + W + + ++ K+ FW+ I Sbjct: 101 HKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSKANTPFWIPI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,752,565 Number of Sequences: 28952 Number of extensions: 309893 Number of successful extensions: 797 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -