BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G13 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosacch... 29 0.36 SPBC609.02 |ptn1||phosphatidylinositol-3,4,5-trisphosphate3-phos... 27 2.5 SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz... 26 3.4 SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 25 5.9 >SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1935 Score = 29.5 bits (63), Expect = 0.36 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Frame = +3 Query: 102 VQGLLSYPEICAKLINPNQNGKRPHLRKVNDP-SKRFGTYAFRLPDDNGEGGFWVSYEDP 278 V L+SYP++ ++ + + +LR++N P + F +A P E GF+V D Sbjct: 1815 VNSLISYPKMNIEVSQSSSDKLLLYLRRLNQPLNPDFYIFAPLFPKPQSE-GFFVLIIDS 1873 Query: 279 DT----AGNKASYVKTKNLGGVSI-MDLSMD 356 +T A +AS+ +N + + + +SMD Sbjct: 1874 ETQELFAIRRASFAGRRNDDSIRLSLRISMD 1904 >SPBC609.02 |ptn1||phosphatidylinositol-3,4, 5-trisphosphate3-phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 26.6 bits (56), Expect = 2.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 395 DRIFISSAKTTKIIHGKVHDGHTAKVLCFHVTSF 294 D +F + T ++H K G T V+C ++ +F Sbjct: 114 DALFQTQPLLTLVVHCKAGKGRTGTVICSYLVAF 147 >SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schizosaccharomyces pombe|chr 2|||Manual Length = 770 Score = 26.2 bits (55), Expect = 3.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 60 IHADEGGEAGPYTKVQGLLSY 122 +H + G AG Y KV+G + Y Sbjct: 562 LHKKQSGGAGQYAKVEGYIEY 582 >SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1379 Score = 25.4 bits (53), Expect = 5.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 LRKKPRSHLHHYHQEGGRHRS 211 LR + H H YH++ G+++S Sbjct: 1190 LRVPQKKHKHFYHRDDGKYKS 1210 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,496,751 Number of Sequences: 5004 Number of extensions: 53763 Number of successful extensions: 133 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -