BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G09 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 ECSAKSKEGVREVFETATRAALQVKKKKKTRCSLL 106 ECSAK+K+GVREVFETATRAALQ KKKKK +C LL Sbjct: 6082 ECSAKTKDGVREVFETATRAALQTKKKKKGKCVLL 6116 >SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +2 Query: 2 ECSAKSKEGVREVFETATRAALQ-VKKKKKTRCSLL 106 ECSA +++G++ VF+ A AAL+ + +KK +C LL Sbjct: 156 ECSALTQKGLKNVFDEAILAALEPPEPQKKKKCRLL 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,623,133 Number of Sequences: 59808 Number of extensions: 365088 Number of successful extensions: 798 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -