BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G09 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 1.9 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 2.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.5 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 499 TETCLV*YFVF*FFNKIVMYK 561 T L+ YF+F +FN +V ++ Sbjct: 14 TSFILINYFIFLYFNSLVRFR 34 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 372 IVGGDHGLPLSEVHL 416 I+GG +GL S+VH+ Sbjct: 264 IIGGSNGLDTSKVHI 278 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.5 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +2 Query: 305 TIGTCIFYRLSI-----KNKCKCLNIIYSRG*SWTSPFRGPFEIFHAIICYIMNL 454 +I +C+F+ + I C I + W R E+F AI+C++ L Sbjct: 374 SIWSCLFFFMLILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFIAIVCFVSYL 428 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 7.5 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +2 Query: 305 TIGTCIFYRLSI-----KNKCKCLNIIYSRG*SWTSPFRGPFEIFHAIICYIMNL 454 +I +C+F+ + I C I + W R E+F AI+C++ L Sbjct: 427 SIWSCLFFFMLILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFIAIVCFVSYL 481 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,142 Number of Sequences: 438 Number of extensions: 3129 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -