BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G08 (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.003 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 38 0.004 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 37 0.008 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.014 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.024 SB_15403| Best HMM Match : CH (HMM E-Value=0) 35 0.031 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.031 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 34 0.055 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 34 0.072 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 33 0.096 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 33 0.096 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 33 0.13 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 33 0.13 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.29 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 32 0.29 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 31 0.67 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 29 2.7 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 2.7 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 2.7 SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) 28 3.6 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 4.7 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 4.7 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 27 6.3 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 27 6.3 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12293| Best HMM Match : OATP (HMM E-Value=0) 27 8.3 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 27 8.3 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ENC ST + PVCGSDN TY N+ Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE 297 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ENC ST + PVCG+DN TY N+ Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNE 183 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C E C T + PV G+DNK Y N+ Sbjct: 90 CVEPCPKTLK--PVYGTDNKNYDNE 112 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQGRL 472 C +NC ST++ PVCGSD KTYKN+ L Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECEL 3995 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +C C+ E PVCG+D KTY+N Sbjct: 4236 ECPSRCLPDKE--PVCGADGKTYRN 4258 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ENC ST + PVCGSDN TY N+ Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE 1228 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ENC ST + PVCG+DN TY N+ Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNE 1157 Score = 32.3 bits (70), Expect = 0.22 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 +C+E+C T + PVCGSDN Y N+ Sbjct: 1372 ECSEDCPKTLK--PVCGSDNNDYDNE 1395 Score = 31.9 bits (69), Expect = 0.29 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQGRL 472 C +C + P+CGS+NKTY N+ L Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECEL 316 Score = 30.7 bits (66), Expect = 0.67 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 422 NPVCGSDNKTYKNQGRL 472 +PVCGSD+KTY N+ R+ Sbjct: 617 DPVCGSDSKTYPNECRM 633 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ++C T E P+C SD +TY N+ Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNE 2176 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C + C T + PVC SDN TY N+ Sbjct: 1580 CPKICPITLD--PVCASDNNTYPNE 1602 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 422 NPVCGSDNKTYKNQGRL 472 +PVCGSDN TY ++ +L Sbjct: 227 DPVCGSDNVTYASECQL 243 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C E C T + PV G+DNK Y N+ Sbjct: 1064 CVEPCPKTLK--PVYGTDNKNYDNE 1086 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C E C T + PV G+DNK Y N+ Sbjct: 1277 CVEPCPKTLK--PVYGTDNKNYDNE 1299 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ---GRLFCAQN 487 C+ I T EY+P+CGSD KTY NQ R C QN Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQN 5187 Score = 34.7 bits (76), Expect = 0.041 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C N I T EY PVCG+D ++Y N+ Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSYDNE 5246 Score = 30.3 bits (65), Expect = 0.89 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 383 EKCAENCISTTEYNPVCGSDNKTYKNQ 463 EK + +Y PVCG+D +TY+N+ Sbjct: 5547 EKRLHRNTCSLDYTPVCGTDGETYENE 5573 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 401 CISTTEYN-PVCGSDNKTYKNQGRL 472 C S N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQGRL 472 +C + I + Y PVCG+D + Y N+ L Sbjct: 5292 ECVCDGICSLVYAPVCGTDGQEYSNECNL 5320 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 401 CISTTEY-NPVCGSDNKTYKNQGRL 472 C+S +PVCGSD K Y N+ L Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNL 5814 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ENC ST + PVCG+DN TY N+ Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNE 49 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C E C T + PV G+DNK Y N+ Sbjct: 98 CVEPCPKTLK--PVYGTDNKNYDNE 120 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 36.3 bits (80), Expect = 0.014 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +C + C T +Y PVCGSDNKTY N Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYAN 217 Score = 35.9 bits (79), Expect = 0.018 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +2 Query: 374 QTIEKCAENCISTTEYNPVCGSDNKTYKN 460 Q + C E C T EY PVCGSD KTY N Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPN 63 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 +C + C T EY P CG+D TY N+ Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNR 301 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +C C T E PVCG+D KTY N Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDN 139 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +C C T E NPVCGSD KTY N Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDN 139 Score = 33.9 bits (74), Expect = 0.072 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 383 EKCAENCISTTEYNPVCGSDNKTYKN 460 +KCA C Y PVCGSDN TY N Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSN 190 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 380 IEKCAENCISTTEYNPVCGSDNKTYKNQGRLFCA 481 ++ C C + Y PVCG+D KTY N+ L A Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAA 72 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 35.1 bits (77), Expect = 0.031 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 KC + T EY PVCGSD TY N Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNN 745 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +2 Query: 419 YNPVCGSDNKTYKNQGRL---FCAQ 484 Y+P+CG+D KTY N L CAQ Sbjct: 1243 YDPICGTDGKTYNNDKDLESAACAQ 1267 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 +C +C S PVCG D +TY N+ Sbjct: 972 ECPRSCPSVNY--PVCGDDGQTYDNE 995 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.1 bits (77), Expect = 0.031 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 410 TTEYNPVCGSDNKTYKNQGRL 472 T +YNPVCGSD +TY N+ + Sbjct: 15 TADYNPVCGSDGRTYPNRASM 35 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 34.3 bits (75), Expect = 0.055 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 386 KCAEN-CISTTEYNPVCGSDNKTYKN 460 KC ++ + T +Y+PVCGSD KTY N Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGN 49 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 33.9 bits (74), Expect = 0.072 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 383 EKCAENCISTTEYNPVCGSDNKTYKN 460 +KCA C Y PVCGSDN TY N Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSN 47 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 33.5 bits (73), Expect = 0.096 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 383 EKCAENCISTTEYNPVCGSDNKTYKN 460 +KCA C Y PVCGSDN TY N Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSN 61 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 33.5 bits (73), Expect = 0.096 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 380 IEKCAENCISTTEYNPVCGSDNKTYKNQ 463 I +C N T Y PVCG+D KTY N+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNK 61 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 33.1 bits (72), Expect = 0.13 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 374 QTIEKCAENCISTTEYNPVCGSDNKTYKNQ 463 Q + +C C T EY PVCGSD KTY + Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTE 69 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +2 Query: 398 NCISTTEYNPVCGSDNKTYKNQ 463 NC ST + PVCGSDN TY N+ Sbjct: 2 NCSSTVD--PVCGSDNNTYDNE 21 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 +C ++T EY PVC SD K Y N+ Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNR 1991 Score = 32.7 bits (71), Expect = 0.17 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 KC C T EY PVCG+D KTY N+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNK 1317 Score = 31.9 bits (69), Expect = 0.29 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 KC + + T +Y PVC SD KTY N+ Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNR 1545 Score = 29.5 bits (63), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 410 TTEYNPVCGSDNKTYKN 460 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQ 463 +C I Y+PVCGSD Y N+ Sbjct: 1364 QCVCPSICPLHYSPVCGSDGNMYSNE 1389 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 419 YNPVCGSDNKTYKNQ 463 Y+PVC S+ KTY N+ Sbjct: 1604 YDPVCASNGKTYSNR 1618 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQGRL 472 KC + S +PVCGSD K YK+ L Sbjct: 1753 KCPPSICSPV-ISPVCGSDGKIYKDDCEL 1780 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 31.9 bits (69), Expect = 0.29 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 416 EYNPVCGSDNKTYKNQGRL 472 E +PVCGSD KTY+N+ +L Sbjct: 516 EASPVCGSDGKTYENECKL 534 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKN 460 C NC S +++PVCG D TY+N Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQN 600 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 371 RQTIEKCAENCISTTEYNPVCGSDNKTYKNQGRL 472 RQ + C ++ PVCGSD +TY N RL Sbjct: 430 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRL 463 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 383 EKCAENCISTT----EYNPVCGSDNKTYKN 460 E E CI T Y+PVCGS+ KTY N Sbjct: 1814 EDGTEVCICPTYCRLNYDPVCGSNRKTYLN 1843 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 422 NPVCGSDNKTYKNQ 463 +PVCG+DNK Y N+ Sbjct: 822 DPVCGTDNKEYANE 835 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C ++C Y P+C S+ KT+ NQ Sbjct: 1361 CTKSC--PLSYEPLCASNGKTFPNQ 1383 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 410 TTEYNPVCGSDNKTY 454 T +Y PVCG D K+Y Sbjct: 1758 TLKYTPVCGDDGKSY 1772 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 374 QTIEKCAENCISTTEYNPVCGSDNKTYKN 460 Q I C E C T ++ VCGS+ +TY N Sbjct: 1886 QAICVCDEKC--TFAFDAVCGSNGRTYIN 1912 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 31.9 bits (69), Expect = 0.29 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 380 IEKCAENCISTTEYNPVCGSDNKTYKNQGRLFCA 481 ++KC C + + PVCG+D KTY N+ L A Sbjct: 21 VDKCVRPCPAIND--PVCGTDGKTYGNECMLGAA 52 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 30.7 bits (66), Expect = 0.67 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 380 IEKCAENCISTTEYNPVCGSDNKTYKNQ 463 I +C N Y+P+CG+D KTY N+ Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNK 61 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 77 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 211 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKN 460 C+ +C PVCGSD+ TY N Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTYAN 31 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKNQGRLFCAQ 484 +C E C S E +PVCG+D +TY ++ L A+ Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHLQLAK 235 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKN 460 C +C T Y+PVCG D TY N Sbjct: 252 CPSDCSHT--YSPVCGGDKTTYIN 273 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 28.7 bits (61), Expect = 2.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 425 PVCGSDNKTYKNQ 463 PVCGSD KTY N+ Sbjct: 1078 PVCGSDGKTYNNE 1090 >SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) Length = 870 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 452 KFYYRYHTRGCIRLLKCNSPRISQLFVVMFHQ 357 ++Y R R++ CNSP + + V++F+Q Sbjct: 87 QYYLAIVCRSSTRIIFCNSPEVKRKNVILFYQ 118 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 425 PVCGSDNKTYKNQGRLFCAQ 484 PVCGSD KTY N L A+ Sbjct: 246 PVCGSDGKTYTNGCELATAK 265 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKN 460 C + + P+CG D KTY+N Sbjct: 177 CPQESQCDLKNRPICGEDEKTYRN 200 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 92 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 223 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 401 CISTTEY-NPVCGSDNKTYKNQGRL 472 C+S +PVCGSD K Y N+ L Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNL 135 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 401 CISTTEYN-PVCGSDNKTYKNQGRL 472 C+S + N PVCGS+ K Y N+ L Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECEL 229 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +CAE+C T + CGSD TYKN Sbjct: 20 ECAESC--PTYDDERCGSDGVTYKN 42 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 27.5 bits (58), Expect = 6.3 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +2 Query: 89 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 268 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 269 HFIAFIFP 292 + IFP Sbjct: 669 GDMNTIFP 676 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/36 (25%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +3 Query: 3 YLYLCYKICHINYFYY----YNLKWISCARFLYWVL 98 +L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 122 WLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 386 KCAENCISTTEYNPVCGSDNKTYKN 460 +CAE+C T + CGSD TYKN Sbjct: 174 ECAESC--PTYDDERCGSDGVTYKN 196 >SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 389 CAENCISTTEYNPVCGSDNKTYKNQ 463 C NC T N CG DN TY N+ Sbjct: 300 CPHNC--ATYENQRCGEDNVTYTNE 322 >SB_12293| Best HMM Match : OATP (HMM E-Value=0) Length = 1446 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 389 CAENC-ISTTEYNPVCGSDNKTY 454 C C S+T+Y PVCG D TY Sbjct: 899 CNVGCQCSSTDYFPVCGVDKITY 921 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +2 Query: 401 CISTTEYNPVCGSDNKTY 454 C+ + ++NPVCG+D+ TY Sbjct: 137 CVKS-QFNPVCGADDVTY 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,161,009 Number of Sequences: 59808 Number of extensions: 335716 Number of successful extensions: 1137 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -