BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G07 (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 2.8 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 3.7 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 8.6 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 304 ALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVXINDVVVEKLVTFFD 483 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 484 YSQ 492 Y Q Sbjct: 240 YGQ 242 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.70 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 245 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 337 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +1 Query: 94 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 225 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 28.7 bits (61), Expect = 3.7 Identities = 24/97 (24%), Positives = 40/97 (41%) Frame = +2 Query: 266 HLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*SLILKRNFISSAXKS 445 +L HST T S L T T ++++ T + TLTH +IT S I Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 446 MMLSLRN*SHSLTIANLMPLTVYS*PKKRLRLVTHTT 556 + L+ +HS + + + + +TH+T Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITHST 121 Score = 28.7 bits (61), Expect = 3.7 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +2 Query: 230 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*S 403 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 404 LILKRNFISSAXKSMMLSLRN*SH 475 + S L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 344 SISYXTGLWVTLTHSSIT*SLILKRNFISSAXKSMMLSLRN*SHS-LTIANLMPLTV 511 ++++ T + +TLTHS++T + N S L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 151 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRC 29 P H NQ C IC+ G KS KCP L S RC Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARC 285 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 109 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 249 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,535,833 Number of Sequences: 59808 Number of extensions: 347265 Number of successful extensions: 1001 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -