BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G06 (524 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 94 9e-22 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 94 9e-22 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 0.83 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 4.4 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 5.8 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 93.9 bits (223), Expect = 9e-22 Identities = 49/89 (55%), Positives = 59/89 (66%) Frame = -1 Query: 464 VISWAIAQTVTTFAGIISYPFDTVRRRMMIQYVRAKCDNHYEYPIQSWTTIPKIEVGTPL 285 +ISW IAQ VTT AGI+SYPFDTVRRRMM+Q RAK + Y+ + W TI K E G Sbjct: 213 LISWGIAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATIYKTEGGNAF 272 Query: 284 VTGALSDVVRAAAGAFVMVLGRLTIKNLL 198 GA S+++R GA V+VL IKNLL Sbjct: 273 FKGAFSNILRGTGGALVLVLYD-EIKNLL 300 Score = 40.3 bits (90), Expect = 1e-05 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 522 FGFYDTAPGMLPDPKNTP 469 FGFYDTA GMLPDPK TP Sbjct: 194 FGFYDTARGMLPDPKKTP 211 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 93.9 bits (223), Expect = 9e-22 Identities = 49/89 (55%), Positives = 59/89 (66%) Frame = -1 Query: 464 VISWAIAQTVTTFAGIISYPFDTVRRRMMIQYVRAKCDNHYEYPIQSWTTIPKIEVGTPL 285 +ISW IAQ VTT AGI+SYPFDTVRRRMM+Q RAK + Y+ + W TI K E G Sbjct: 213 LISWGIAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATIYKTEGGNAF 272 Query: 284 VTGALSDVVRAAAGAFVMVLGRLTIKNLL 198 GA S+++R GA V+VL IKNLL Sbjct: 273 FKGAFSNILRGTGGALVLVLYD-EIKNLL 300 Score = 40.3 bits (90), Expect = 1e-05 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 522 FGFYDTAPGMLPDPKNTP 469 FGFYDTA GMLPDPK TP Sbjct: 194 FGFYDTARGMLPDPKKTP 211 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 504 APGMLPDPKNTPHRHQLGHRPN 439 APG P P +P Q G PN Sbjct: 20 APGPQPSPHQSPQAPQRGSPPN 41 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -3 Query: 471 PHRHQLGHRPNRHHIRRYH 415 PH H +GH + H +H Sbjct: 414 PHHHTMGHGHSHIHATPHH 432 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 489 PDPKNTPHRHQLGHRPNRHHIRRYHLVS 406 P P+ TP + R R RY+ VS Sbjct: 394 PPPRQTPPSRKESGRRRRRRTPRYNSVS 421 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 Query: 308 WEWSSMIEWGTRNDCRTWPGRTGSSYAYEP 397 W+ S I GT +P G YEP Sbjct: 155 WKNPSRIVGGTNTGINEFPMMAGIKRTYEP 184 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,196 Number of Sequences: 438 Number of extensions: 2836 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -