BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_G03 (595 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom... 31 0.17 SPAC19B12.02c |||1,3-beta-glucanosyltransferase|Schizosaccharomy... 28 0.89 SPAC1687.12c |coq4||ubiquinone biosynthesis protein Coq4|Schizos... 28 1.2 SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|c... 27 1.6 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 27 2.1 SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc... 26 3.6 SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 25 6.3 SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosa... 25 6.3 SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual 25 6.3 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 25 6.3 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 25 8.3 SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch... 25 8.3 >SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 326 Score = 30.7 bits (66), Expect = 0.17 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 310 YYLHDYSLNAHYYYHHLT 363 +Y YSLN H +YHHLT Sbjct: 258 WYSTSYSLNFHLFYHHLT 275 >SPAC19B12.02c |||1,3-beta-glucanosyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 28.3 bits (60), Expect = 0.89 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 238 ICKWKDSTRSCVIRELQSFGQYAKFHRY 155 +C+ DSTRSCVI + S Y+ Y Sbjct: 366 VCECMDSTRSCVINDDVSSDDYSDLFSY 393 >SPAC1687.12c |coq4||ubiquinone biosynthesis protein Coq4|Schizosaccharomyces pombe|chr 1|||Manual Length = 272 Score = 27.9 bits (59), Expect = 1.2 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +1 Query: 373 WLGGDVVPLLKERRGEWYWFVHKQLVNTLLYGKT 474 W GGD++ +L + G+ + F+H+ L+N +L KT Sbjct: 74 WRGGDMISVLGDASGQPF-FLHR-LLNKMLVDKT 105 >SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 433 Score = 27.5 bits (58), Expect = 1.6 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +3 Query: 261 VEYYCLALPLPKRFYVLLLT*LQFKCPLLLSSS----DLQQVARRRCSSSIKR 407 V Y C + K +Y +L + +CP++++S D++ VA S+ IKR Sbjct: 124 VVYVCERKFIRKEYYFAILMDRENQCPMIVASDQGGVDIETVAAENPSAIIKR 176 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 27.1 bits (57), Expect = 2.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 109 GYAIPPIYEVLPEYFNNGEILHTAQRI 189 GY +PP+Y++ + + E+L +Q I Sbjct: 666 GYVLPPVYKITQIHSGDTELLQLSQEI 692 >SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 430 Score = 26.2 bits (55), Expect = 3.6 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 238 ICKWKDSTRSCVIRELQSFGQYAKFHRY*NI--PVKPHILEE*RNLLSQNDEC 86 IC W T+S E + AK+HR+ +I V+ H E L S +D+C Sbjct: 207 ICLWDVQTQSFTSSETKVISPIAKYHRHTDIVNDVQFHPQHE-ALLASVSDDC 258 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 25.4 bits (53), Expect = 6.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 465 WKDFLMDLVKIGET*W 512 WK+ +M+L+K ET W Sbjct: 622 WKNIVMELIKASETIW 637 >SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.4 bits (53), Expect = 6.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 177 CPKDWSSRITHDRVLSFHL 233 CPK WS I H R SF + Sbjct: 501 CPKVWSKIINHPRFESFDI 519 >SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 214 EYYPSTYKWDNSVVIRSNTTVW 279 + YP+ + W + +IRSN W Sbjct: 205 QQYPAAFLWSLATLIRSNGIFW 226 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.4 bits (53), Expect = 6.3 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 7/125 (5%) Frame = +1 Query: 133 EVLPEYFN--NGEILHTAQRIGVHGSRMIEYYPSTYKWDNSVVIRSNTTVWHYHCQSASM 306 EV+P FN N I +++ S ++D S + N+ C S+ + Sbjct: 325 EVIPFSFNPYNDLIFSFKEKLYPLNSSPFNTLSDVPQFDVSEFVDENSFDSSSSC-SSKV 383 Query: 307 SYYLHDYSLNAHYYYHH--LTYNKWLGGDVVPLLKERRGEWYWF---VHKQLVNTLLYGK 471 + S+N+ H L+YN+ LG D+ + +R + Y F + +LV+ L Sbjct: 384 FLTTRNNSINSEDSAHEVLLSYNRVLGSDIQGTILDRVKKGYQFDSQKNSELVSDLYLKD 443 Query: 472 TF*WI 486 + WI Sbjct: 444 LWSWI 448 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 25.0 bits (52), Expect = 8.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 388 HRLLATCCKSDDDNNSGHLNCNHV 317 H L+ K+DDD ++ HL +H+ Sbjct: 800 HALMRYLGKTDDDEDNSHLLVHHI 823 >SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 292 QSASMSYYLHDYSLNAHYYYHHLTYNKWLG 381 Q+A + Y HD +L H Y H +N W+G Sbjct: 336 QAAGIFY--HDLALRPHAYQH---FNTWMG 360 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,660,882 Number of Sequences: 5004 Number of extensions: 58157 Number of successful extensions: 144 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -