BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F24 (437 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0031 - 40603243-40603491,40603617-40603799,40603896-406040... 28 2.9 04_01_0422 + 5573833-5574647,5575577-5575692,5576922-5577130,557... 27 6.6 10_08_0253 - 16196275-16196307,16196425-16196550,16196643-161967... 27 8.7 >01_07_0031 - 40603243-40603491,40603617-40603799,40603896-40604084, 40604244-40604916,40605583-40605737 Length = 482 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 277 VEALSFIQPTIG-PNVRYTIPAVSNCMPVAPGNLCKGTCVGIT 402 VEA ++ + PNV IPA + C+P + G V +T Sbjct: 234 VEAAKWLHKVVDRPNVYIKIPATAECVPSIKEVIANGISVNVT 276 >04_01_0422 + 5573833-5574647,5575577-5575692,5576922-5577130, 5579676-5579795,5581616-5581744,5581828-5581953, 5582945-5583000,5583084-5583183,5585155-5585272, 5585374-5585583,5585902-5586226,5587094-5587187, 5588021-5588129,5588246-5588514,5589153-5589280, 5589983-5590217,5590858-5591046,5591326-5591609, 5591698-5591890,5592040-5592207,5592429-5592514, 5594391-5594550 Length = 1412 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -1 Query: 377 HKLPGATGIQLLTA--GIVYLTLGPIVGWIKDNASTAVTLHCLNI-FTWMTAVS 225 ++L QL T G + TLGP+V WI + + + H + + W A + Sbjct: 1124 NRLVAGLNAQLRTVRQGNIRSTLGPVVSWINSHGNPQLERHGVRVELGWFQATA 1177 >10_08_0253 - 16196275-16196307,16196425-16196550,16196643-16196741, 16196822-16197001,16197090-16197371,16197471-16199141, 16199257-16199463,16199566-16199700,16199792-16200082, 16200403-16200621,16200876-16201034,16201120-16201181, 16201257-16201383,16201460-16201693,16201777-16202003, 16202163-16202257,16202341-16202468,16202574-16202594, 16202765-16202921,16203007-16203075,16203228-16203341, 16203415-16203491,16203576-16203688,16204432-16204507, 16204592-16204756,16204825-16204952,16205049-16205130, 16205426-16205548,16205633-16205860,16205933-16206034, 16206144-16206341,16206581-16206760,16206868-16207020, 16207690-16207797,16208201-16208355,16208786-16208912, 16209825-16209914,16209986-16210127,16210303-16210379, 16210467-16210582,16210638-16210773,16211130-16211198, 16211279-16211361,16211655-16211720,16211788-16211974, 16212054-16213547,16213635-16214165,16214234-16214363, 16214407-16215878,16216359-16216364,16216750-16217055, 16217364-16217468,16217577-16217772,16217862-16217929, 16218853-16220631,16221026-16221151,16221604-16221780, 16221997-16222128,16223461-16223498,16223710-16223788, 16224175-16224284,16224787-16224935,16225027-16225197, 16225281-16225552,16226355-16226442,16227942-16228369 Length = 5157 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 283 ALSFIQPTIGPNVRYTIPAVSNCMPVAPGNLCKGTCVGITKA 408 A + +P + P RYT+P V +P+AP L + VG+ +A Sbjct: 47 AAALAEPLLHP--RYTVPVVGCFLPLAPALLDR--AVGLLRA 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,852,997 Number of Sequences: 37544 Number of extensions: 162495 Number of successful extensions: 436 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -