BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F23 (549 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1654 - 28416487-28416548,28416791-28416824,28418156-284182... 33 0.15 04_01_0046 + 510721-510790,511048-511121,511459-511729,511865-51... 29 3.2 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 28 4.3 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 5.6 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 7.5 04_04_1392 + 33201015-33201600,33202030-33202406,33202528-332026... 27 9.9 >07_03_1654 - 28416487-28416548,28416791-28416824,28418156-28418212, 28418401-28418450,28418968-28419025,28419136-28419182, 28419278-28419377,28419446-28419586,28419715-28419780, 28420024-28420118,28420440-28420629 Length = 299 Score = 33.1 bits (72), Expect = 0.15 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +1 Query: 46 PVWCHRKRITSRQKMSTQCLWSARKRVLSLFQDVDQVNVDDEYYKIGKDYDVEANI 213 P C+ +R+ + +MS + WS V +L D+ + V+D +YK G+ D++ I Sbjct: 53 PASCYFRRVLAEGRMSRR--WSRTIYVGNLPGDIREREVEDLFYKYGRIVDIDLKI 106 >04_01_0046 + 510721-510790,511048-511121,511459-511729,511865-512243, 512550-512771,513130-513259,514311-514367,514756-515046 Length = 497 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 63 KTYHFKTKDVDAVFVERQKKGFIPF 137 K H +T+DVDA +R G IPF Sbjct: 7 KDIHIQTEDVDAFIKDRGSMGVIPF 31 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 28.3 bits (60), Expect = 4.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 352 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAV 447 Y KD FY + + + EG+FL ++Y+ + Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQI 728 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 399 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 253 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.5 bits (58), Expect = 7.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 377 TRVPLSL-VCT*MRDSSCTHIILQLSSAMILMDSFYQLLMK 496 T+ P S V T + S+CTH QLSSA +L + +K Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLLSSQLKEKELK 105 >04_04_1392 + 33201015-33201600,33202030-33202406,33202528-33202638, 33202720-33202815,33202899-33203570 Length = 613 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 327 SLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 211 S FP + E GE+ V GK+ D + SF + V ++ Sbjct: 500 SKFPSAISESGEITVEGKVKDGIPHLTKVGSFQVDVSLE 538 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,823,086 Number of Sequences: 37544 Number of extensions: 265534 Number of successful extensions: 606 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -