BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F15 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.42 SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) 30 1.3 SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 35.5 bits (78), Expect = 0.034 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +2 Query: 521 LESNNECCGVEDTVVNKIVGGNDTKIHQYPW 613 +++N E CGV D+ +++V G+D + ++PW Sbjct: 45 VQTNAEHCGVSDSASSRVVSGDDATLGEWPW 75 >SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) Length = 1007 Score = 31.9 bits (69), Expect = 0.42 Identities = 23/75 (30%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +2 Query: 398 VRQSVCNGPETFS---VCCGPPPEINPEDMTLNERCSRAVTAFPLESNNECCGVEDTVVN 568 +R CN P VC G E N E +RC P CGV + + Sbjct: 381 LRSRKCNNPTPQGGGRVCAG---EGNQEKACNTQRCGAKPVLAPF-----ICGVRNAL-G 431 Query: 569 KIVGGNDTKIHQYPW 613 +IVGG K+ +PW Sbjct: 432 RIVGGQTAKVEDWPW 446 >SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) Length = 667 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 236 SQCGYENNIPMVCCPISNACKTPDDKPGICVGLYNC 343 S C + IP +C P ++AC T DD C+G C Sbjct: 528 STCPVMSRIPYMCNPTTHACDTDDD----CIGGAKC 559 >SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 189 SEIKAEQLRIRNF*ETHNVV-MRIIYLWCAVPFQTLVRLQTINREFVSV 332 S+++A R R + TH ++ M +I+L+C PF + + E S+ Sbjct: 222 SQVQANTARYRKY--THTMIWMFVIFLFCYTPFMLTSAVASFGTETASI 268 >SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1528 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 Query: 275 CPISNACKTPDDKPGICVGLYNCE 346 C N C+ P +C G NCE Sbjct: 1436 CKCGNCCEMPQQIENVCCGKRNCE 1459 >SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 186 KFSK-GSQSYRDTQFPDSFLGVVQVCARIKFTDINRIYETVEKIIILLLFI 37 +FSK G + Q PD LG V + + INR+Y + ++ + F+ Sbjct: 234 EFSKNGQNTIEAVQNPDMELGSVNSLSAVDIMQINRLYNCPQARLLGVCFV 284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,060,554 Number of Sequences: 59808 Number of extensions: 390178 Number of successful extensions: 1118 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1115 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -