BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F11 (523 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 1.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 3.3 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 288 ITCEPITENDVRNLYYNGSMIYEK*ILYYNITS 190 ITC+ +T+ RNL + +IYE + Y+ S Sbjct: 12 ITCQGVTDIHSRNLTNSLKVIYEWKYIDYDFGS 44 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 221 KNKYYTTILLAVAAALPAWNSDNLLVYVLPLDVNSTSLPTFI 96 + K TT+ + ++A + W +L V P N ++P F+ Sbjct: 367 ERKASTTLGIIMSAFIVCWLPFFVLALVRPFLKNPDAIPAFL 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,503 Number of Sequences: 438 Number of extensions: 2758 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -