BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F09 (620 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20270.1 68418.m02413 expressed protein contains Pfam domain,... 29 1.9 At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase,... 29 3.3 At3g57420.1 68416.m06393 expressed protein contains Pfam domain ... 28 5.7 At2g32460.1 68415.m03965 myb family transcription factor (MYB101... 28 5.7 At1g65640.1 68414.m07446 DegP protease, putative contains simila... 28 5.7 >At5g20270.1 68418.m02413 expressed protein contains Pfam domain, PF03006: Uncharacterised protein family (Hly-III / UPF0073) Length = 332 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 450 YEVLPEYSNNGEF-LAYCPKDWSSRITHDRVLSFH 551 Y LPEY + E+ L Y DWS R V SFH Sbjct: 59 YCELPEYMKDNEYILNYYRADWSIRDAFFSVFSFH 93 >At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Spinacia oleracea SP|P28645, Olea europaea SP|Q43593; contains Pfam profile PF03405 Fatty acid desaturase Length = 396 Score = 28.7 bits (61), Expect = 3.3 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 3/98 (3%) Frame = +3 Query: 111 PNHVSKSITISASWSIENNINHYKNETAVKIWILMKKQNWLLPLSVPF-SPLNPTHQFEA 287 P H+ S T + N + H T K+ I +NW + + P+ + Q + Sbjct: 36 PRHLQVSKTFRPIKEVSNQVTH--TITQEKLEIFKSMENWAQENLLSYLKPVETSWQPQ- 92 Query: 288 VIMFNVLYSAKDYDTFYKTTVYMKDRVNQ--DLYIYVL 395 + L KD D FY+ ++DR + D Y VL Sbjct: 93 ----DFLPETKDEDRFYEQVKELRDRTKEIPDDYFVVL 126 >At3g57420.1 68416.m06393 expressed protein contains Pfam domain PF03385: Protein of unknown function, DUF288 Length = 765 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 324 YDTFYKTTVYMKDRVNQDLYIYVLSTLHIHR 416 Y +KT V + R N DLY+ HI++ Sbjct: 534 YGRIFKTVVILSSRKNSDLYVQEAKLDHIYK 564 >At2g32460.1 68415.m03965 myb family transcription factor (MYB101) identical to putative transcription factor MYB101 GI:18087348 from [Arabidopsis thaliana] Length = 490 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 543 IVLDHA*SVNSNPLGSMPKIHRYWNIP 463 +++DH S N + LG+ P IH +N P Sbjct: 374 LLIDHLNSSNHSSLGANPNIHNKYNEP 400 >At1g65640.1 68414.m07446 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 518 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 417 SDLEGYAIPP--IYEVLPEYSNNGEFLAYCPKDWSSRITHDRVLSFHLQMG 563 +D GY IP I L NG++ +C D S ++ + L H +MG Sbjct: 246 ADNIGYIIPTPVIKHFLTAVEENGQYGGFCTLDISYQLMENSQLRNHFKMG 296 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,788,601 Number of Sequences: 28952 Number of extensions: 293495 Number of successful extensions: 710 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -