BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F08 (602 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 81 3e-17 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 5.8 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 81.0 bits (191), Expect = 3e-17 Identities = 47/150 (31%), Positives = 80/150 (53%), Gaps = 4/150 (2%) Frame = +3 Query: 69 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 248 MA+ L + +I + + FS++D +G G + +LG +R+L NPT EL + G Sbjct: 1 MANDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPT-IELIGKMGGTQKRG 59 Query: 249 NGTIDFPEFLTIMA--RKMKDTDSEEEIREAFRVFDKDGNGFISAGELRHVMTNLGEKLT 422 I F EFL I + +K K+ E+ E +++DK+ +G + EL H +T LGE+L Sbjct: 60 EKKIKFEEFLPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLD 119 Query: 423 DEEVDEIIREA--DIDGERQVNYEEFVTMM 506 D E+D ++++ D + + Y F+ M Sbjct: 120 DVELDNVMKDCMDPEDDDGNIPYAPFLKKM 149 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 5.8 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 143 RHHHNQRAWHRHEI 184 RHHH++ H H++ Sbjct: 491 RHHHHRAGLHHHDL 504 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,168 Number of Sequences: 2352 Number of extensions: 8746 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -