BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F07 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39648| Best HMM Match : DUF1110 (HMM E-Value=1.7) 27 7.3 SB_40204| Best HMM Match : KOW (HMM E-Value=0.00011) 27 7.3 >SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +2 Query: 155 RN*EPIY-QPEWQLQAHPWVQCL 220 R+ EPIY P + ++HPW QC+ Sbjct: 360 RSVEPIYIMPLAEKESHPWYQCI 382 >SB_39648| Best HMM Match : DUF1110 (HMM E-Value=1.7) Length = 472 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/37 (29%), Positives = 26/37 (70%) Frame = +2 Query: 185 WQLQAHPWVQCLVSVILT*QLFVKISMKGLLILSRVY 295 W+++A V+C+VS+ + ++ V+ ++ L+ +SRV+ Sbjct: 30 WRVRARFCVECVVSIAVVWRVRVRFCVECLVSISRVW 66 >SB_40204| Best HMM Match : KOW (HMM E-Value=0.00011) Length = 1198 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -2 Query: 264 IEIFTKSCYVNITLTKHWTQ---GWACSCHSGWYIGSQFR 154 I IF KSC + L + W + WA +C S Y G F+ Sbjct: 400 IHIF-KSCDEGLELQEKWAKVALNWATTCSSRHYAGRSFQ 438 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,378,354 Number of Sequences: 59808 Number of extensions: 252424 Number of successful extensions: 509 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -