BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F07 (535 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005002-1|AAH05002.1| 192|Homo sapiens mitochondrial ribosomal... 90 4e-18 AK223112-1|BAD96832.1| 192|Homo sapiens mitochondrial ribosomal... 90 4e-18 AF151871-1|AAD34108.1| 192|Homo sapiens CGI-113 protein protein. 90 4e-18 AB049638-1|BAB40843.1| 192|Homo sapiens mitochondrial ribosomal... 90 4e-18 BC108277-1|AAI08278.1| 166|Homo sapiens mitochondrial ribosomal... 89 9e-18 AB051338-1|BAB54928.1| 61|Homo sapiens mitochondrial ribosomal... 38 0.022 >BC005002-1|AAH05002.1| 192|Homo sapiens mitochondrial ribosomal protein L11 protein. Length = 192 Score = 90.2 bits (214), Expect = 4e-18 Identities = 39/75 (52%), Positives = 56/75 (74%) Frame = +1 Query: 223 QRNINIAAFCKDFNERTANIKQGVPLPTRVKVNADRSYQLVIHQAPSSYFLKQAAGISRG 402 QR ++I FCK+FNERT +IK+G+PLPT++ V DR++++ I Q SYFLK AAGI +G Sbjct: 41 QRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG 100 Query: 403 AMEPVRETSGKITLK 447 A + +E +G +TLK Sbjct: 101 ARQTGKEVAGLVTLK 115 >AK223112-1|BAD96832.1| 192|Homo sapiens mitochondrial ribosomal protein L11 isoform a variant protein. Length = 192 Score = 90.2 bits (214), Expect = 4e-18 Identities = 39/75 (52%), Positives = 56/75 (74%) Frame = +1 Query: 223 QRNINIAAFCKDFNERTANIKQGVPLPTRVKVNADRSYQLVIHQAPSSYFLKQAAGISRG 402 QR ++I FCK+FNERT +IK+G+PLPT++ V DR++++ I Q SYFLK AAGI +G Sbjct: 41 QRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG 100 Query: 403 AMEPVRETSGKITLK 447 A + +E +G +TLK Sbjct: 101 ARQTGKEVAGLVTLK 115 >AF151871-1|AAD34108.1| 192|Homo sapiens CGI-113 protein protein. Length = 192 Score = 90.2 bits (214), Expect = 4e-18 Identities = 39/75 (52%), Positives = 56/75 (74%) Frame = +1 Query: 223 QRNINIAAFCKDFNERTANIKQGVPLPTRVKVNADRSYQLVIHQAPSSYFLKQAAGISRG 402 QR ++I FCK+FNERT +IK+G+PLPT++ V DR++++ I Q SYFLK AAGI +G Sbjct: 41 QRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG 100 Query: 403 AMEPVRETSGKITLK 447 A + +E +G +TLK Sbjct: 101 ARQTGKEVAGLVTLK 115 >AB049638-1|BAB40843.1| 192|Homo sapiens mitochondrial ribosomal protein L11 (L11mt) protein. Length = 192 Score = 90.2 bits (214), Expect = 4e-18 Identities = 39/75 (52%), Positives = 56/75 (74%) Frame = +1 Query: 223 QRNINIAAFCKDFNERTANIKQGVPLPTRVKVNADRSYQLVIHQAPSSYFLKQAAGISRG 402 QR ++I FCK+FNERT +IK+G+PLPT++ V DR++++ I Q SYFLK AAGI +G Sbjct: 41 QRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG 100 Query: 403 AMEPVRETSGKITLK 447 A + +E +G +TLK Sbjct: 101 ARQTGKEVAGLVTLK 115 >BC108277-1|AAI08278.1| 166|Homo sapiens mitochondrial ribosomal protein L11 protein. Length = 166 Score = 89.0 bits (211), Expect = 9e-18 Identities = 38/75 (50%), Positives = 56/75 (74%) Frame = +1 Query: 223 QRNINIAAFCKDFNERTANIKQGVPLPTRVKVNADRSYQLVIHQAPSSYFLKQAAGISRG 402 +R ++I FCK+FNERT +IK+G+PLPT++ V DR++++ I Q SYFLK AAGI +G Sbjct: 15 ERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG 74 Query: 403 AMEPVRETSGKITLK 447 A + +E +G +TLK Sbjct: 75 ARQTGKEVAGLVTLK 89 >AB051338-1|BAB54928.1| 61|Homo sapiens mitochondrial ribosomal protein L11 protein. Length = 61 Score = 37.9 bits (84), Expect = 0.022 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +1 Query: 346 IHQAPSSYFLKQAAGISRGAMEPVRETSGKITLK 447 I Q SYFLK AAGI +GA + +E +G +TLK Sbjct: 2 IGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLK 35 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,402,259 Number of Sequences: 237096 Number of extensions: 1339282 Number of successful extensions: 2197 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2197 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -