BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_F01 (503 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 2.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 4.7 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 8.3 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 8.3 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 8.3 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 8.3 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 162 KNIAPNGDDTTFLSSLDVYASLRSFSEALS 73 +N+ D+TTF++ +DV R+ E L+ Sbjct: 441 ENLKTTPDNTTFITLVDVSTKRRTELEDLT 470 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 74 DKASLKLLKEAYTSSDDKN 130 DK K +KE YT ++ N Sbjct: 262 DKKKKKTIKEKYTEDEELN 280 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 8.3 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = +2 Query: 167 SLYRDGAGKQSQEEI 211 ++YR G G+ +QE++ Sbjct: 32 AIYRPGIGRYAQEDL 46 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 20.6 bits (41), Expect = 8.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 92 VSVRLYRWHRLGLS 51 + + L+RW ++GLS Sbjct: 14 ILIPLFRWPKIGLS 27 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 20.6 bits (41), Expect = 8.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 390 STKARSTLLISKTLKKAADIINQ 458 S K + +L+ KTL + A +NQ Sbjct: 75 SPKIKRMVLLHKTLVRVAKSLNQ 97 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 20.6 bits (41), Expect = 8.3 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +3 Query: 192 NKAKKRSTMCWAVKNIFRWILYTLS 266 N+ K R + + N+F W++ +S Sbjct: 89 NEPKLRHYLIFIFVNVFFWVIILMS 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,591 Number of Sequences: 336 Number of extensions: 2679 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -