BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E22 (358 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0908 + 22507565-22507810,22507925-22508872,22509314-225103... 27 4.3 05_01_0150 + 1000613-1001275 27 4.3 07_03_0831 - 21810002-21810319,21810423-21810573,21810660-218108... 27 5.7 >07_03_0908 + 22507565-22507810,22507925-22508872,22509314-22510337, 22510425-22510477 Length = 756 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 354 GK*SLTMFVPNMFHSL*AYSTMFLLPSE 271 GK LT FVPN H L STM +L ++ Sbjct: 187 GKYRLTEFVPNHNHQLATASTMHMLKAK 214 >05_01_0150 + 1000613-1001275 Length = 220 Score = 27.1 bits (57), Expect = 4.3 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -1 Query: 214 EGLHYCSLVVADNYTVVQLFVRVDVIEWRKLFVVNKCNREVA*RCKGRLR 65 EG +YCS V D+Y+ Q+++R +K V R +A C GR+R Sbjct: 79 EGWYYCSPRVVDSYSCRQIYLRSYTFSKKKETVP---ERTMA--CLGRVR 123 >07_03_0831 - 21810002-21810319,21810423-21810573,21810660-21810897, 21811011-21811221,21811336-21811559,21811696-21811806, 21813265-21813636,21813810-21814782 Length = 865 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 275 EGKRNIVEYAYKLWN 319 EG NIV YA++LWN Sbjct: 752 EGSLNIVGYAWQLWN 766 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,204,483 Number of Sequences: 37544 Number of extensions: 128162 Number of successful extensions: 346 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 542368620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -