BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E21 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) 62 3e-10 SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) 60 1e-09 SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) 53 2e-07 SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) 51 7e-07 SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48679| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) 33 0.14 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 33 0.19 SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) 31 0.99 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 30 1.3 SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) 30 1.3 SB_59508| Best HMM Match : PhdYeFM (HMM E-Value=2.1) 30 1.3 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 30 1.3 SB_49730| Best HMM Match : DUF59 (HMM E-Value=8.9) 30 1.7 SB_20152| Best HMM Match : CRAL_TRIO_N (HMM E-Value=2.6) 30 1.7 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) 30 1.7 SB_41647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_54890| Best HMM Match : XH (HMM E-Value=3.4) 29 3.0 SB_51435| Best HMM Match : Hydrolase (HMM E-Value=5.6) 29 3.0 SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) 29 3.0 SB_34051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_29532| Best HMM Match : Herpes_UL1 (HMM E-Value=4.7) 29 3.0 SB_18494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_8787| Best HMM Match : Hydrolase (HMM E-Value=5.6) 29 3.0 SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) 29 3.0 SB_46790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_26392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_51174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_15845| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_16817| Best HMM Match : zf-CCCH (HMM E-Value=0.15) 29 4.0 SB_15473| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_2282| Best HMM Match : PHZA_PHZB (HMM E-Value=4.4) 29 4.0 SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) 28 5.3 SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) 28 5.3 SB_56169| Best HMM Match : DUF433 (HMM E-Value=1.8) 28 5.3 SB_51239| Best HMM Match : tRNA_m1G_MT (HMM E-Value=7.1) 28 5.3 SB_33650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_30839| Best HMM Match : NOG1 (HMM E-Value=7) 28 5.3 SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) 28 5.3 SB_27442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) 28 5.3 SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) 28 5.3 SB_55934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_44640| Best HMM Match : LIM (HMM E-Value=0.44) 28 5.3 SB_43172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 28 5.3 SB_31537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_16988| Best HMM Match : DUF59 (HMM E-Value=9.1) 28 5.3 SB_5577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_58628| Best HMM Match : Tenui_NCP (HMM E-Value=4.5) 28 7.0 SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) 28 7.0 SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_50080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 28 7.0 SB_24037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_22294| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_21089| Best HMM Match : DUF1502 (HMM E-Value=8.4) 28 7.0 SB_20292| Best HMM Match : DUF495 (HMM E-Value=3.7) 28 7.0 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 28 7.0 SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) 28 7.0 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) 28 7.0 SB_58547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_54893| Best HMM Match : CheR (HMM E-Value=3.2) 28 7.0 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_52771| Best HMM Match : DUF58 (HMM E-Value=5.4) 28 7.0 SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 28 7.0 SB_45218| Best HMM Match : tRNA_m1G_MT (HMM E-Value=9.8) 28 7.0 SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_35917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 28 7.0 SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 28 7.0 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_18029| Best HMM Match : LIM (HMM E-Value=0.44) 28 7.0 SB_17263| Best HMM Match : DUF1621 (HMM E-Value=8.7) 28 7.0 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 28 7.0 SB_14653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_13849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_11477| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_10023| Best HMM Match : DUF1502 (HMM E-Value=9.2) 28 7.0 SB_7013| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 28 7.0 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 28 7.0 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 28 7.0 SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) 28 7.0 SB_1074| Best HMM Match : ScdA_N (HMM E-Value=2.4) 28 7.0 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_19805| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_12489| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_3725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_51229| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_44330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) Length = 195 Score = 62.1 bits (144), Expect = 3e-10 Identities = 54/189 (28%), Positives = 88/189 (46%), Gaps = 8/189 (4%) Frame = +3 Query: 69 YFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFKPS--TPFAQMPVLVI-DGKQYAQS 239 YF +A E R+LL F D RV DW K S PF ++P+L I DG++ AQS Sbjct: 9 YFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDGRKLAQS 68 Query: 240 TAICRYLGRKYGIAGANEEESFEIDQNVEFLHDIRAKSASVFYEADEELKAKKHEDFAKN 419 AI R+L A E E + +++ + F E +K +K ++F + Sbjct: 69 HAIFRFL--------AKEHEGGD------------SRNGAFFKR--EHVKEQKSKEFHEE 106 Query: 420 VYPDMLEKIHAIIKKN---NGHIAAGKLTWGDFVFTGMFE-YLKM-MLQIPDLEVKYPAF 584 P LE I+ + ++N G++ K+T+ D F F ++ L +P+ KYP Sbjct: 107 TLPKRLEFINKLFQENKGGKGYLVGDKITYADIDFFCFFNGFINSGKLDVPEQLSKYPLL 166 Query: 585 QETYQQCID 611 + Y + ++ Sbjct: 167 VDLYNRVMN 175 >SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) Length = 79 Score = 60.1 bits (139), Expect = 1e-09 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = +3 Query: 48 MPKVVFHYFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFKPS--TPFAQMPVLVIDG 221 MP +YF+ + E R++ + G +FED+R+ +WP K PF Q+P+LVID Sbjct: 1 MPSYKLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDD 60 Query: 222 K-QYAQSTAICRYLGRK 269 K + AQS AI ++ R+ Sbjct: 61 KIKLAQSLAIMTFIARE 77 >SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) Length = 102 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 4/78 (5%) Frame = +3 Query: 48 MPKVVFHYFSCKALGESGRMLLSYGGQDFEDHRVLS-ADWPDFKP--STPFAQMPVLVID 218 MP HYF+ + E R+ + G ++ED R +W KP PF Q+P+LVID Sbjct: 23 MPSYKLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPPFGQVPLLVID 82 Query: 219 GK-QYAQSTAICRYLGRK 269 K + AQS AI Y+ R+ Sbjct: 83 DKIKLAQSMAILAYVARE 100 >SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) Length = 221 Score = 51.2 bits (117), Expect = 7e-07 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 2/119 (1%) Frame = +3 Query: 48 MPKVVFHYFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFKP--STPFAQMPVLVIDG 221 MP YF+ + E R+ + GG +ED R+ +W K T +PVL +DG Sbjct: 1 MPNYKLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVDG 60 Query: 222 KQYAQSTAICRYLGRKYGIAGANEEESFEIDQNVEFLHDIRAKSASVFYEADEELKAKK 398 QY +S AI R + G+ E D + + + + + F++ E L K Sbjct: 61 IQYCESMAIFRLAAKLAGLCPTCPYEQARCDMK-KLQEEFKEQHLNKFWDIMERLLTAK 118 >SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 38.3 bits (85), Expect = 0.005 Identities = 44/186 (23%), Positives = 74/186 (39%), Gaps = 5/186 (2%) Frame = +3 Query: 69 YFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFKPSTPFAQMPVLVIDGKQYAQSTAI 248 YF +A GE R+LL F + R DWP K S + Y Q A Sbjct: 95 YFDVRARGECIRVLLHLADVPFTEERHGLEDWPAVKSS---------LAPSDDYLQ--AR 143 Query: 249 CRYLGRKYGIAGANEEESFEIDQNVEFLHDIRAKSASVFYEADEELKAKKHEDFAKNVYP 428 C L +D N + + + + +E DE + + F + P Sbjct: 144 CDML----------------VDNNKDMMD----RLGEIVWELDEVRQEMLKKKFYDEILP 183 Query: 429 DMLEKIHAIIKKNN---GHIAAGKLTWGDFVFTGMFE-YLK-MMLQIPDLEVKYPAFQET 593 +E I+ ++++NN G++ K+T+ D F F Y+ L +P+ KYP + Sbjct: 184 VQMENINKLLQENNGGKGYLVGDKITYADIDFFCFFNGYINGGKLDVPEQFSKYPLLADL 243 Query: 594 YQQCID 611 Y + ++ Sbjct: 244 YNRVMN 249 >SB_48679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 195 QMPVLVIDGKQY---AQSTAICRYLGRKYGIAGANEEESFEID 314 Q+P + K++ QS AI RY+GRKY + G EEE +D Sbjct: 3 QLPYYIDGDKKHIKITQSNAILRYIGRKYDMCGKTEEEKVIVD 45 >SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) Length = 1502 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = -1 Query: 251 ADCCALGILFTVDHQNWHLGERCAWFEVWPISR*YSVVFEVLATVREKHATALTEGLARE 72 ++ C + + QN W V+P Y + E+L ++R+K A A+ GL + Sbjct: 525 SEFCVIDDSVVIRRQNSDFELEIGWHRVYPNMDAY--IEEILDSMRDKEAPAVLAGLVQN 582 Query: 71 IVEHDLRHD 45 I++ D+ D Sbjct: 583 ILDEDIPDD 591 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/76 (23%), Positives = 34/76 (44%) Frame = +3 Query: 18 QGESRNKILIMPKVVFHYFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFKPSTPFAQ 197 + + N+ PK+ + + R L Y G D+ V + + ST + + Sbjct: 83 ENSASNEASHQPKITLYQYQTCPFCCKVRAYLEYFGIDYTKVEVNPLTRKEIEFSTEYRK 142 Query: 198 MPVLVIDGKQYAQSTA 245 +P+ ++DGKQ ST+ Sbjct: 143 VPIAIVDGKQPGGSTS 158 >SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) Length = 317 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = -1 Query: 179 WFEVWPISR*YSVVFEVLATVREKHATALTEGLAREIVEHDLRHD 45 W +V P Y + EVL ++R+K A A+ GL + I++ D+ D Sbjct: 34 WHKVCPNMDAY--IEEVLGSMRDKEAPAVLAGLVQNILDEDIPDD 76 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 128 LATVREKHATALTEGLAREIVEHDLRHD 45 +A REK AT + G +REIV+ L HD Sbjct: 456 IADAREKLATLVASGKSREIVDKALTHD 483 >SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) Length = 280 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 78 CKALGESGRMLLSYGGQDFEDHR 146 C+ LG+ R+LL Y +DFED R Sbjct: 194 CQKLGQPIRLLLKYTNEDFEDKR 216 >SB_59508| Best HMM Match : PhdYeFM (HMM E-Value=2.1) Length = 204 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 128 LATVREKHATALTEGLAREIVEHDLRHD 45 +A REK AT + G +REIV+ L HD Sbjct: 41 IADAREKLATLVASGKSREIVDKALTHD 68 >SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) Length = 678 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -1 Query: 179 WFEVWPISR*YSVVFEVLATVREKHATALTEGLAREIVEHDLRHD 45 W +V P Y + E+L ++R+K A A+ GL + I++ D+ D Sbjct: 252 WLKVCPSMDAY--IEEILDSMRDKEAPAVLAGLVQNILDEDIPDD 294 >SB_49730| Best HMM Match : DUF59 (HMM E-Value=8.9) Length = 631 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL R I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVRNILDEDIPDD 36 >SB_20152| Best HMM Match : CRAL_TRIO_N (HMM E-Value=2.6) Length = 490 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = -1 Query: 179 WFEVWPISR*YSVVFEVLATVREKHATALTEGLAREIVEHDLRHD 45 W +V P Y + EVL ++R+K A A+ GL + I++ D+ D Sbjct: 54 WHKVCPNMDAY--IEEVLNSMRDKEAPAVLAGLVQNILDEDIPDD 96 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 265 VNTVSPEQTKRNPSKSIRTLNSCMTFAPSPH 357 VN +PE+ K+ P+ +RT N C+ + P+ Sbjct: 961 VNKFNPEELKKQPNSVLRTSNHCLGYLCLPN 991 >SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1118 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -1 Query: 179 WFEVWPISR*YSVVFEVLATVREKHATALTEGLAREIVEHDLRHD 45 W +V P Y + E+L ++R+K A A+ GL + I++ D+ D Sbjct: 112 WLKVCPNMDAY--IEEILDSMRDKEAPAVLAGLVQNILDEDIPDD 154 >SB_41647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL ++I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQKILDEDIPDD 36 >SB_54890| Best HMM Match : XH (HMM E-Value=3.4) Length = 209 Score = 29.1 bits (62), Expect = 3.0 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 4/94 (4%) Frame = +3 Query: 225 QYAQSTAICRYL---GRKYGIAGANEEESFEIDQNVEFLHDIRAKSASVFYEADEELKAK 395 +Y +S + RYL G K +G + ++ ++ LHD+R + + +K Sbjct: 104 KYEKSLEVLRYLKAQGIKRTKSGIMLGLGEKEEEVIQVLHDLRDANVDIVTIGQYLQPSK 163 Query: 396 KHEDFAKNVYPDMLEKIHAIIKK-NNGHIAAGKL 494 KH + + P+ EK I K+ H+ +G L Sbjct: 164 KHLPVKEYISPEQFEKYEKIGKELGFRHVESGAL 197 >SB_51435| Best HMM Match : Hydrolase (HMM E-Value=5.6) Length = 825 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLSGLVQNILDEDIPED 36 >SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) Length = 835 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLCSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_34051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_29532| Best HMM Match : Herpes_UL1 (HMM E-Value=4.7) Length = 312 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_18494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLCSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_8787| Best HMM Match : Hydrolase (HMM E-Value=5.6) Length = 815 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLSGLVQNILDEDIPED 36 >SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) Length = 666 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 140 VFEVLATVREKHATALTEGLAREIVEHDLRHD 45 V E+L ++R+K A A+ GL + I++ D+ D Sbjct: 5 VEEILGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_46790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_26392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1450 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 128 LATVREKHATALTEGLAREIVEHDLRHD 45 +A REK A + G +RE+V DL HD Sbjct: 1025 IADAREKLAIRIASGKSREMVGKDLTHD 1052 >SB_51174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLDSMRDKEAPAVLAGLVQNILDEDIPED 36 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 372 ADEELKAKKHEDFAKNVYPDMLEKIHAIIKK 464 AD+ LKA+K ED K + D++E+I K+ Sbjct: 2628 ADDTLKAEKTEDTVKALLDDIIERISDTCKR 2658 >SB_15845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSIRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ +D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPND 36 >SB_16817| Best HMM Match : zf-CCCH (HMM E-Value=0.15) Length = 794 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 378 EELKAKKHEDFAKNVYPDMLEKIHAIIKKNNGHIAAGKLT 497 EEL+ K E + V+PD +EKI +++ N + KLT Sbjct: 743 EELRIKAFEQLCE-VFPDSIEKILQLLEDNPKDTSVEKLT 781 >SB_15473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLDSMRDKEAPAVLAGLVQNILDEDIPED 36 >SB_2282| Best HMM Match : PHZA_PHZB (HMM E-Value=4.4) Length = 660 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDITED 36 >SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) Length = 423 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) Length = 1037 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++ +K A A+ GL + I++ D+R D Sbjct: 7 EILNSMPDKEAPAVLAGLVQNILDEDIRED 36 >SB_56169| Best HMM Match : DUF433 (HMM E-Value=1.8) Length = 309 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 128 LATVREKHATALTEGLAREIVEHDLRHD 45 +A REK A + G +RE+V DL HD Sbjct: 177 IADAREKLAILVASGKSREMVGKDLTHD 204 >SB_51239| Best HMM Match : tRNA_m1G_MT (HMM E-Value=7.1) Length = 471 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_33650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 521 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_30839| Best HMM Match : NOG1 (HMM E-Value=7) Length = 581 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) Length = 463 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 417 FSRSPHVSSPSVLHQPRRTPMRTWRECHAGIQRSD 313 + +S H+ + + H R M TW++C RSD Sbjct: 375 YGKSSHLKAHTRTHTGERPFMCTWKDCEKRFARSD 409 >SB_27442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVKNILDEDIPDD 36 >SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) Length = 609 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) Length = 1017 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++ +K A A+ GL + I++ D+R D Sbjct: 7 EILNSMPDKEAPAVLAGLVQNILDEDIRED 36 >SB_55934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_44640| Best HMM Match : LIM (HMM E-Value=0.44) Length = 788 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_43172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDGDIPDD 36 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAILAGLVQNILDEDIPDD 36 >SB_31537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +3 Query: 54 KVVFHYFSCKALGESGRMLLSYGGQDFEDHRVLSADWPDFK 176 +V HYF + E R+++ G + + DWP K Sbjct: 53 QVTLHYFGSRGKAEGIRLMMEDNGVLYAETNYTKEDWPTVK 93 >SB_16988| Best HMM Match : DUF59 (HMM E-Value=9.1) Length = 138 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_5577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_58628| Best HMM Match : Tenui_NCP (HMM E-Value=4.5) Length = 479 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) Length = 265 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = +3 Query: 342 RAKSASVFYEADEELKAKKHEDFAKNVYPDMLEKIHAIIKKNNGHIAAGKLTW 500 R K F E +E + KH F N+ + L +I + K I L W Sbjct: 127 RNKDHKAFTEGCKEPEGPKHRYFLANMLYNTLARIRGVKHKERKRIKKSPLAW 179 >SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLAGLVQNILDEDIPGD 36 >SB_50080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -3 Query: 510 RSHPMSTSQQRCVRYSSL*WRESSPAYRGIRFSRSPHVSSPSVLHQPRR 364 R+ P S S+QR V S RE S + +FS HV+S S Q R Sbjct: 616 RNRPSSQSEQRHVNSQSS-AREKSLSQTEFKFSEESHVTSKSSHGQTER 663 >SB_24037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDL 54 EVL ++R+K A A+ GL + I++ D+ Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDI 33 >SB_22294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_21089| Best HMM Match : DUF1502 (HMM E-Value=8.4) Length = 139 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 97 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 126 >SB_20292| Best HMM Match : DUF495 (HMM E-Value=3.7) Length = 895 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVPNILDEDIPDD 36 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 956 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL I++ D+ D Sbjct: 7 EVLGSMRDKEAPAVLAGLVPNILDEDIPDD 36 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1064 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) Length = 860 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 110 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 139 >SB_58547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 211 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 240 >SB_54893| Best HMM Match : CheR (HMM E-Value=3.2) Length = 537 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_52771| Best HMM Match : DUF58 (HMM E-Value=5.4) Length = 667 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDL 54 EVL ++R+K A A+ GL + I++ D+ Sbjct: 7 EVLGSMRDKEAPAVLAGLVQNILDEDI 33 >SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A+ GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAVLVGLVQNILDEDIPDD 36 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_45218| Best HMM Match : tRNA_m1G_MT (HMM E-Value=9.8) Length = 361 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_35917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 128 LATVREKHATALTEGLAREIVEHDLRHD 45 +A REK A + G +RE+V DL HD Sbjct: 444 VADAREKLAILVASGKSREMVGKDLTHD 471 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_18029| Best HMM Match : LIM (HMM E-Value=0.44) Length = 885 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_17263| Best HMM Match : DUF1621 (HMM E-Value=8.7) Length = 265 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = +3 Query: 342 RAKSASVFYEADEELKAKKHEDFAKNVYPDMLEKIHAIIKKNNGHIAAGKLTW 500 R K F E +E + KH F N+ + L +I + K I L W Sbjct: 127 RNKDHKAFTEGCKEPEGPKHRYFRANMLYNTLARIRGVKHKERKRIKKSPLAW 179 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_14653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_13849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_11477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_10023| Best HMM Match : DUF1502 (HMM E-Value=9.2) Length = 151 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 116 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 145 >SB_7013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQSILDEDIPDD 36 >SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 514 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) Length = 636 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDEDIPDD 36 >SB_1074| Best HMM Match : ScdA_N (HMM E-Value=2.4) Length = 694 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 140 VFEVLATVREKHATALTEGLAREIVEHDLRHD 45 V E+L ++R+K A A+ GL + I++ D+ D Sbjct: 5 VEEILDSMRDKEAPAVLAGLVQNILDEDIIDD 36 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAALAGLVKNILDEDIPDD 36 >SB_19805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 426 GIRFSRSPHVSSPSVLHQPRRTPMRTWRECHAGIQ 322 GIR R + H R P WR CH IQ Sbjct: 49 GIRHPREKNPHGIRNSHARMRNPKPYWRTCHGAIQ 83 >SB_12489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A AL GL + I++ ++ D Sbjct: 7 EVLDSMRDKEAPALLAGLVQNILDENIPDD 36 >SB_3725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 E+L ++R+K A A+ GL + I++ D+ D Sbjct: 7 EILDSMRDKEAPAVLAGLVQNILDKDIPDD 36 >SB_51229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 120 RKREACDRSHRGPCTRNSGTR 58 R +E CD+ G CTR+SG + Sbjct: 329 RVKECCDKRAGGTCTRHSGRK 349 >SB_44330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 570 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 134 EVLATVREKHATALTEGLAREIVEHDLRHD 45 EVL ++R+K A A GL + I++ D+ D Sbjct: 7 EVLNSMRDKEAPAALAGLVQNILDEDIPDD 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,309,230 Number of Sequences: 59808 Number of extensions: 402518 Number of successful extensions: 1484 Number of sequences better than 10.0: 107 Number of HSP's better than 10.0 without gapping: 1365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1480 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -