BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E20 (427 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 27 0.28 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 27 0.28 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 1.5 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 27.1 bits (57), Expect = 0.28 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 81 MKKITFAVACLLALSSVYAG 140 MK++TF CLLAL+ AG Sbjct: 1 MKRLTFVTGCLLALAFAKAG 20 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 27.1 bits (57), Expect = 0.28 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 81 MKKITFAVACLLALSSVYAG 140 MK++TF CLLAL+ AG Sbjct: 1 MKRLTFVTGCLLALAFAKAG 20 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.6 bits (51), Expect = 1.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 265 PTPTSTSSGHTNICYLLHISTNYKINRAGFSKMFRKLSDE 384 PTP+ S H + + HI + +NR K + SD+ Sbjct: 1466 PTPSKKSKRHQSASPIRHILNSPLLNRRQRKKQHTESSDD 1505 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,004 Number of Sequences: 2352 Number of extensions: 7925 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -