BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E20 (427 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29740.1 68414.m03636 leucine-rich repeat family protein / pr... 29 1.7 At1g29730.1 68414.m03634 leucine-rich repeat transmembrane prote... 27 7.0 >At1g29740.1 68414.m03636 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1049 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +2 Query: 179 YNDNFVSGQV*RAIRRIQ*LQPRRWRTSGLRQPLPQAVIRI 301 ++DN ++G + I + LQ SGL+ P+P ++ R+ Sbjct: 225 FSDNRLNGSIPEFIGNLSKLQRLELYASGLKDPIPYSIFRL 265 >At1g29730.1 68414.m03634 leucine-rich repeat transmembrane protein kinase, putative contains Pfam domains, PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 940 Score = 26.6 bits (56), Expect = 7.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 182 NDNFVSGQV*RAIRRIQ*LQPRRWRTSGLRQPLPQAVIRI 301 +DN ++G + I ++ LQ SGLR P+P ++ + Sbjct: 226 SDNRLNGSIPEFIGKLPKLQRLELYASGLRGPIPDSIFHL 265 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,350,268 Number of Sequences: 28952 Number of extensions: 141769 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -