BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E19 (404 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 30 0.62 SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) 28 2.5 SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) 28 3.3 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 28 3.3 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 28 3.3 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.4 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 5.8 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.9 bits (69), Expect = 0.20 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +1 Query: 106 EDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAA 285 +++P V+ + TIN + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 286 TAGLAY-DNVNGHGATLT-KTHIPGFGDKMTAAGKVN 390 ++Y DN+N A T + IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 30.3 bits (65), Expect = 0.62 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -3 Query: 183 GTIRVDSESTRL---PAHPRVSPLLRLILILFD---VVTRLFNKHVTAV 55 G + V+ + RL HPR SPLL+L+ D VV LF +HV AV Sbjct: 614 GKVAVEEKRPRLLRSEFHPRRSPLLQLLSNTPDVHVVVVELFQRHVHAV 662 >SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) Length = 1325 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 210 YGYLDHSTGGTIRVDSESTRLPAHPRVSPL 121 Y YL H T T + DS STR+ RV L Sbjct: 935 YAYLHHDTRTTCKYDSYSTRIYTATRVRQL 964 >SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) Length = 624 Score = 27.9 bits (59), Expect = 3.3 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 2/96 (2%) Frame = +1 Query: 76 EEPGYYIEQYE--DQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGS 249 E Y E+YE D AN QA + N+ ++G ++ + ++G + K+ A S Sbjct: 113 ERSEYGGERYETSDFQRSVANRYKELQADSWKKNNVTSAGGLLSLDLSGEGHFKVHANAS 172 Query: 250 VDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGF 357 + + Y + A L HIPGF Sbjct: 173 TAIPAAETTDWPQENI-YSTIQYQEAPLPPAHIPGF 207 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 27.9 bits (59), Expect = 3.3 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +1 Query: 1 HSKMFAKLFLVSVLLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTINSDG 180 HS + L L L+ GV + +++ Y E ++ E W + R+ + AGAL++ S Sbjct: 1039 HSYLLTNLALADFLM-GVYMLLIAIKDVEYQGEYFKHDIE-WRSGRLCQFAGALSLTSSE 1096 Query: 181 TS 186 S Sbjct: 1097 VS 1098 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.9 bits (59), Expect = 3.3 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 266 WLVRSTEPRALSLWFSLPVMGTLTIAPEVPSELIV 162 W+V ++EP LS + ++ T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.5 bits (58), Expect = 4.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 252 D*TKSTELVVFIASYGYLDHSTGGTIRVDSES 157 D +K+ E + IA++ L+H+ G I DSES Sbjct: 800 DLSKALEDIKNIAAFNVLEHAKSGEIESDSES 831 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.1 bits (57), Expect = 5.8 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +1 Query: 58 SRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLS 237 +R + EP ++ EDQ E A+S +R +AG +D G + + T N NH Sbjct: 1183 ARKAQINEPPSPLKVQEDQRETEAHSPIRTRAGREATCNDHLKGCVNQA--TCN-NHLKG 1239 Query: 238 ALGSVDLTNQMKLGAATAGLAYDNVNG 318 + + +K G D++ G Sbjct: 1240 CVNQATCNDHLK-GCVNQATCNDHLKG 1265 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 70 LVEEPGYYIEQYEDQPEQW 126 L EEPGYYIE + PE W Sbjct: 210 LDEEPGYYIE--KKAPESW 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,167,461 Number of Sequences: 59808 Number of extensions: 234822 Number of successful extensions: 465 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -