BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E17 (545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 24 0.76 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 7.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.0 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.3 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 24.2 bits (50), Expect = 0.76 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 216 YNNNIGVFWWSNSCFLSLNNTGISF 142 YNN ++W N C L+L+ I F Sbjct: 48 YNNTNRKYYWLNVCCLNLSIVTIFF 72 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 483 LANTSEPVGL*SISTSPRWQLT 418 LA VGL S+ST W++T Sbjct: 88 LAIADLAVGLISVSTDIAWRIT 109 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 Query: 299 EKDFSYKASQENLKNVALTQHFALPEN 379 + +YK + +N + TQH P N Sbjct: 369 QSGINYKDTNDNNVSAVTTQHQGYPTN 395 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 23 TSWSTGWRRLNSVPGLQEFGEADSFYSTRSPLIKTWNV 136 T W TGW+ + S L + ++F++ + + N+ Sbjct: 674 TDWYTGWKNMLSDELLAQPTIKENFHTALEIMNRAVNI 711 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 458 DYNQYQHHQDGN*HLLKSQQ*TVREVY 378 DY+ H + HLL S Q +++ Y Sbjct: 214 DYSSLTHSLAASNHLLSSGQHLLQDTY 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,938 Number of Sequences: 336 Number of extensions: 2534 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -