BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E17 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.7 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 6.2 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 75 SCSPGTLFRRRHPVLQLVPLVRYA 4 +C PG + RR P + P R+A Sbjct: 407 ACCPGRVRRRYQPAFRCKPSQRFA 430 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -1 Query: 545 FVIHILFAMLHFLLVFQHIFHWLTPVNPWD 456 ++I + +A+ + L+ + W T NPW+ Sbjct: 115 YIIILAWALFYLLVSLRIDLPWRTCGNPWN 144 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -1 Query: 545 FVIHILFAMLHFLLVFQHIFHWLTPVNPWD 456 ++I + +A+ + L+ + W T NPW+ Sbjct: 168 YIIILAWALFYLLVSLRIDLPWRTCGNPWN 197 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 339 FKFSCDALYEKSFSKITTERPS 274 FK + LY++ +S+ TERP+ Sbjct: 281 FKGTYKTLYKQMWSQNITERPT 302 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,036 Number of Sequences: 438 Number of extensions: 2942 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -