BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E14 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0528 - 29782382-29782864,29782994-29783092,29783319-297833... 30 1.3 08_01_0914 + 9010613-9013316,9013537-9013748 28 5.2 >02_05_0528 - 29782382-29782864,29782994-29783092,29783319-29783387, 29783781-29783888,29783965-29784274,29784772-29784812, 29784886-29784942,29785290-29785448,29785587-29785655, 29785728-29785877,29785967-29786098,29786347-29786433, 29786516-29786686,29786760-29786960,29787348-29787416, 29787510-29787618,29787887-29788005,29788676-29788780, 29789377-29789755,29790022-29790150,29790223-29790402, 29791310-29791469,29791604-29791744,29791832-29792021, 29792100-29792161,29792879-29793107 Length = 1335 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 305 NSIRMAFLGAVSERMRNLKHRRGEIILQFLPTINNHVITSSVLQTA 442 N I + +LG V++ +++L H RG + + + HV+ + Q+A Sbjct: 739 NGINVRYLGKVADMIKHLPHLRGLLSSEIIVRSAKHVVKEILRQSA 784 >08_01_0914 + 9010613-9013316,9013537-9013748 Length = 971 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -3 Query: 208 IHILLFLFYNSIINSLCIVKNTVLHFSAINLK*SVHINEELWIN 77 +H+L+F ++I+S+C + T F +K +V NE L++N Sbjct: 656 LHVLIFCIVGTLISSMCCM--TAYCFIKRKMKLNVVDNENLFLN 697 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,272,697 Number of Sequences: 37544 Number of extensions: 329294 Number of successful extensions: 761 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -