BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E12 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) 31 0.56 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 3.9 SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 6.9 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 27 9.1 SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_8348| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) Length = 733 Score = 31.5 bits (68), Expect = 0.56 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -1 Query: 601 LLDSNGYTKTKNWNGYPPSVPLGNINLFGMHSKPSDIYNGTFPSS--NNFMRSVNGKE 434 ++DS G N+ G+ VP G++ L+G H+ + FP S N+F+ V G+E Sbjct: 439 IVDSFGTEAQFNYAGFTEKVPGGSMALWGRHNLNLKQFMTMFPHSPDNSFLGFVVGEE 496 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 278 DLDNGISGNIGLNVDGN 228 ++D G+SGN LNVDG+ Sbjct: 397 NIDTGVSGNFSLNVDGS 413 >SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 327 ENWHKFYELDWFTHKITPGQNKIVRN 404 + WHK YELD F K + N I+RN Sbjct: 66 KEWHK-YELDKFMEKTSSYHNTILRN 90 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +3 Query: 120 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIATDAVIKIFLGPKYN 299 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 273 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 332 Query: 300 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 413 G + L +W + ++L+W + K+ G+N + + E Sbjct: 333 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +3 Query: 120 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIATDAVIKIFLGPKYN 299 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 756 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 815 Query: 300 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 413 G + L +W + ++L+W + K+ G+N + + E Sbjct: 816 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 51 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 143 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 1 VTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 141 +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 10 LTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 >SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -3 Query: 278 DLDNGISGNIGLNVDGNT--ERLVVES 204 ++D G+ GN LN+DG+ E+L+VE+ Sbjct: 340 NIDVGVGGNFTLNMDGSALIEKLLVET 366 >SB_8348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +3 Query: 288 PKYNDXGFPITLEENWHKFYELDWFTHKITPGQNKIVR-NSNEFSLFKEDSLPXTDLMKL 464 PK P + E+ KFYE + + +I PG+ + V N N + ++ L +L +L Sbjct: 160 PKKGGRALPSDVLEHIVKFYESEEYP-RICPGKKEFVSVNENNVKVHRQKQLLLVNLHEL 218 Query: 465 LDEGK 479 E K Sbjct: 219 YVEYK 223 >SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1495 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 320 CDGESXIVVLRSQEDLDNGISGNIG-LNVDGNTERLVVESW 201 C ES ++LR+ ED+ + GN+G LN+ T+ V SW Sbjct: 815 CGAESNELILRTFEDVPSVAPGNVGTLNLTSMTDLRV--SW 853 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,486,138 Number of Sequences: 59808 Number of extensions: 345022 Number of successful extensions: 919 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -