BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E12 (613 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila F... 36 0.085 BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic p... 29 9.8 AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein. 29 9.8 >X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila Fat protein protein. Length = 4590 Score = 36.3 bits (80), Expect = 0.085 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = -3 Query: 314 GESXIVVLRSQEDLDNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSL 165 G S ++ +R+ D D+G +G + ++D + V+ES+ N+E W+T+L Sbjct: 2826 GGSRVIQIRAS-DADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL 2874 >BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic protein 1-like protein. Length = 842 Score = 29.5 bits (63), Expect = 9.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 96 LVTFFDYSQFDATNSVFLTKKEIKTSYPHNFKVRQPR 206 L F DY F+ NS L KK+I+T+ NF + R Sbjct: 411 LPDFLDYFSFNFPNSPVLGKKDIETTTMSNFHAQVKR 447 >AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein. Length = 249 Score = 29.5 bits (63), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 581 YENKELEWISTFSTSWQHQSIWHAFKTFRHIQ 486 Y N +W+ W Q +WHA T+ H Q Sbjct: 202 YSNLVYDWVKAGRPLWCCQHLWHASTTWTHPQ 233 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,712,577 Number of Sequences: 237096 Number of extensions: 1639230 Number of successful extensions: 14828 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14828 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -