BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E07 (596 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_56637| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-06) 29 2.9 SB_47699| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-23) 29 2.9 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 29 3.8 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 5.0 SB_1254| Best HMM Match : Peptidase_U57 (HMM E-Value=0.98) 27 8.7 >SB_23849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = -2 Query: 403 NFNTSCYLHTGFHYRHPCAFCSVCFNGQTE 314 N + H Y HPC +C C G + Sbjct: 13 NLSALTNTHQALFYPHPCCYCEACLAGNND 42 >SB_56637| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-06) Length = 269 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 351 APSAVCASMAKLS--FSCKALALAMSLFSIASSISRASLGNRLNEVP 217 AP + S AK++ F+C ALA A+S F + A LG+ N VP Sbjct: 130 APLKIIVSEAKVARVFACTALAFAISWFPVLYYTIAAVLGS-FNSVP 175 >SB_47699| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-23) Length = 335 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 351 APSAVCASMAKLS--FSCKALALAMSLFSIASSISRASLGNRLNEVP 217 AP + S AK++ F+C ALA A+S F + A LG+ N VP Sbjct: 196 APLKIIVSEAKVARVFACTALAFAISWFPVLYYTIAAVLGS-FNSVP 241 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 28.7 bits (61), Expect = 3.8 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 2/105 (1%) Frame = -3 Query: 459 WIRCFASADIGLCGSDGGPTLI--PVAISIPAFIIGTHAPSAVCASMAKLSFSCKALALA 286 W+ AS+++ L S G L+ P+ ++ + + T++ + + FS L + Sbjct: 195 WMLDLASSNLSL--SSGAKILVSCPINLTANSLTMQTNSQFNIFGNGKVSHFSLNNLDID 252 Query: 285 MSLFSIASSISRASLGNRLNEVPILDFMPRSAAGANSVSAPRNIS 151 L A S+ L + + +LDF P GAN+++ S Sbjct: 253 GILRPAALSVGIGILSVNIRQHGVLDFAPYGPFGANALNVEGTFS 297 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 588 PDTPSSILLPPDVHYVTLNRSPIFP 514 PDTPSS PD HY + P+ P Sbjct: 211 PDTPSSAEKAPDAHYKVPSSRPLPP 235 >SB_1254| Best HMM Match : Peptidase_U57 (HMM E-Value=0.98) Length = 375 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 588 PDTPSSILLPPDVHYVTLNRSPIFP*SLSYSFYLVNPKL 472 P TP + VH VTLN S FP + Y+ PKL Sbjct: 15 PRTPLGLKAEKTVHRVTLNPSTAFP---GETLYVAVPKL 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,899,320 Number of Sequences: 59808 Number of extensions: 380964 Number of successful extensions: 1045 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -