BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_E07 (596 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81463-8|CAB03849.2| 346|Caenorhabditis elegans Hypothetical pr... 29 1.9 AF003134-5|AAB54139.1| 357|Caenorhabditis elegans Nek (never in... 29 3.3 U28739-7|AAB93458.1| 681|Caenorhabditis elegans Cell division c... 27 7.7 U28739-6|AAM54206.1| 695|Caenorhabditis elegans Cell division c... 27 7.7 U28739-4|AAM54205.1| 693|Caenorhabditis elegans Cell division c... 27 7.7 U28739-3|AAB93459.1| 1063|Caenorhabditis elegans Cell division c... 27 7.7 AY661746-1|AAT74545.1| 695|Caenorhabditis elegans CDC-14 phosph... 27 7.7 AY661745-1|AAT74544.1| 681|Caenorhabditis elegans CDC-14 phosph... 27 7.7 AY661744-1|AAT74543.1| 1063|Caenorhabditis elegans CDC-14 phosph... 27 7.7 AY661743-1|AAT74542.1| 693|Caenorhabditis elegans CDC-14 phosph... 27 7.7 AF000363-1|AAB94407.1| 681|Caenorhabditis elegans protein phosp... 27 7.7 >Z81463-8|CAB03849.2| 346|Caenorhabditis elegans Hypothetical protein C06B8.6 protein. Length = 346 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = -3 Query: 405 PTLIPVAISIPAFIIGTHAPSAVCASMAKLSFSCKALALAMSLFSIASSISRASLGNRLN 226 P L +S+P F++ +A + SM +L F C A M F + SI + GN L+ Sbjct: 181 PCLSSEILSLPLFVVAENAGLMLITSMMELGFLCAQGAFLM--FLLNRSIKK--FGNHLS 236 Query: 225 E 223 + Sbjct: 237 Q 237 >AF003134-5|AAB54139.1| 357|Caenorhabditis elegans Nek (never in mitosis kinase) likeprotein 2 protein. Length = 357 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 593 PIQTPLRPYSFPPTSITLHLTDLQYSLKASHIHS 492 P Q+ LRPYS + T HLT Q + SHI S Sbjct: 303 PTQSTLRPYSLSSNAPTTHLT--QLTPMPSHIDS 334 >U28739-7|AAB93458.1| 681|Caenorhabditis elegans Cell division cycle related protein14, isoform c protein. Length = 681 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >U28739-6|AAM54206.1| 695|Caenorhabditis elegans Cell division cycle related protein14, isoform d protein. Length = 695 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >U28739-4|AAM54205.1| 693|Caenorhabditis elegans Cell division cycle related protein14, isoform a protein. Length = 693 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >U28739-3|AAB93459.1| 1063|Caenorhabditis elegans Cell division cycle related protein14, isoform b protein. Length = 1063 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >AY661746-1|AAT74545.1| 695|Caenorhabditis elegans CDC-14 phosphatase isoform D protein. Length = 695 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >AY661745-1|AAT74544.1| 681|Caenorhabditis elegans CDC-14 phosphatase isoform C protein. Length = 681 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >AY661744-1|AAT74543.1| 1063|Caenorhabditis elegans CDC-14 phosphatase isoform B protein. Length = 1063 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >AY661743-1|AAT74542.1| 693|Caenorhabditis elegans CDC-14 phosphatase isoform A protein. Length = 693 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 >AF000363-1|AAB94407.1| 681|Caenorhabditis elegans protein phosphatase CDC14 protein. Length = 681 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 63 LVYQTSRVSSSLQMTLTKEPRSYVLSKRAKRCFSELTRY 179 + Y+T S + TLT+ P S V A R SE TRY Sbjct: 523 VAYRTRNSSGNTTSTLTRTPASAVFPSMASR-RSETTRY 560 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,757,890 Number of Sequences: 27780 Number of extensions: 278757 Number of successful extensions: 805 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -