Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0002_D24
         (496 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     22   3.5  
EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    21   6.1  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   6.1  

>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 3.5
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +3

Query: 159 QPGLHRFELRSCK 197
           QPG++R +L SCK
Sbjct: 10  QPGVNRCKLLSCK 22


>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 15/63 (23%), Positives = 31/63 (49%)
 Frame = -2

Query: 483 FILN*IKMSYIIINIDLILVFCWGDKKINKTFFIIYINK*IFDPILLIKRKNYLRDNSVI 304
           + L  I + +II  I L++++C   K +      + +NK I +  L  +++  L   +V+
Sbjct: 237 YFLTIIFLFFIIPLIILLILYCIIAKNLMSNAATLVLNKHIDNISLRARKQVVLMLGTVV 296

Query: 303 FFF 295
             F
Sbjct: 297 LSF 299


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 347 KIGSKIHLFM 376
           K GSKIHLF+
Sbjct: 773 KTGSKIHLFV 782


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,117
Number of Sequences: 336
Number of extensions: 1528
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11630247
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)