BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D24 (496 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 26 2.7 SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces pomb... 25 8.3 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 26.2 bits (55), Expect = 2.7 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 271 ATRCWIKIK-FKCKSLKFLICSIIKILHDLSSNR 173 A RC I F+ +++ L+ SIIK LH +++NR Sbjct: 1094 ALRCLYGIHAFRLYTVEKLVTSIIKQLHSVTTNR 1127 >SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 519 Score = 24.6 bits (51), Expect = 8.3 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 325 VIFSFNQ*NWIKNSFIYVNN--KKSFIYFFVTPTK 423 ++FS+N WI Y+N+ SF+ FV T+ Sbjct: 133 LLFSYNVDTWISKGSSYINSFTTWSFLLVFVCATQ 167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,341,849 Number of Sequences: 5004 Number of extensions: 23472 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -