BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D20 (337 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 0.77 SPAC27D7.12c |but1|SPAC27D7.12, mug107|neddylation pathway prote... 26 1.8 SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe... 25 2.3 SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa... 25 3.1 SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|ch... 25 3.1 SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces po... 25 3.1 SPBC26H8.09c |snf59||SWI/SNF complex subunit Snf59|Schizosacchar... 24 5.4 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 27.1 bits (57), Expect = 0.77 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 207 YWYEFHFVFQVHCVCGRFY---FIHPVIICGYLPFF 109 YW+ F F F H C RF+ FIHP +PFF Sbjct: 76 YWFFFFFFFFSH--CRRFHIAIFIHP-YDSNVVPFF 108 >SPAC27D7.12c |but1|SPAC27D7.12, mug107|neddylation pathway protein But1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 243 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 141 PVIICGY-LPFFVRISSGYADVGVLVVGFNVIGHFFP 34 P++ + L FF +S Y V + + +VI HF+P Sbjct: 99 PILFSSFVLCFFGNVSGDYGYVDNVPLHISVISHFYP 135 >SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 31 SREEMTNHVETDNQDADI 84 S+E++ ++ DNQDADI Sbjct: 277 SKEKIIERIKNDNQDADI 294 >SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1049 Score = 25.0 bits (52), Expect = 3.1 Identities = 14/56 (25%), Positives = 33/56 (58%) Frame = +1 Query: 25 ESSREEMTNHVETDNQDADIGVARGDTDKERQISTNDNWMNKVEATTYAVDLKDEV 192 ESS+E + + E + ++ D+ + GD + + S DN++ K+ + +++L +E+ Sbjct: 410 ESSQEGIRSSSENNKKEDDLKDSTGDLNTTQVSSRVDNFLLKLPSMV-SLELTNEM 464 >SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 563 Score = 25.0 bits (52), Expect = 3.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 125 DICRSLSVSPLATPM 81 D+CRS+ VS L TP+ Sbjct: 266 DLCRSIHVSTLVTPL 280 >SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces pombe|chr 1|||Manual Length = 1564 Score = 25.0 bits (52), Expect = 3.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 213 ITYWYEFHFVFQVHCVCGRFYFIHPVIIC 127 I+ WY FHF Q+ + F + +++C Sbjct: 209 ISQWYFFHFNLQLQLLRVIFLSTYSLVVC 237 >SPBC26H8.09c |snf59||SWI/SNF complex subunit Snf59|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 24.2 bits (50), Expect = 5.4 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 10 TEGMMESSREEMTNHVETDNQD---ADIGVARGDTDKERQISTNDN 138 +E +S REE +HV++ N++ + I GD E +S +D+ Sbjct: 205 SEHNTKSIREEPIHHVDSKNEEPVYSKIPEKMGDEFSENSLSKSDS 250 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,096,717 Number of Sequences: 5004 Number of extensions: 19004 Number of successful extensions: 60 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 95984434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -