BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D20 (337 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56250.2 68418.m07020 expressed protein 32 0.11 At5g56250.1 68418.m07019 expressed protein 32 0.11 At3g25980.1 68416.m03237 mitotic spindle checkpoint protein, put... 28 1.8 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 27 4.1 At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family pr... 26 5.4 At2g22795.1 68415.m02704 expressed protein 26 5.4 At4g21460.1 68417.m03104 expressed protein 26 7.2 At3g14900.1 68416.m01884 expressed protein 25 9.5 At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1 [Ar... 25 9.5 >At5g56250.2 68418.m07020 expressed protein Length = 811 Score = 31.9 bits (69), Expect = 0.11 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 4 PVTEGMMESSREEMTNHVETDNQDADIGVARGDTDKERQISTNDNW 141 PV G+M+ + M ++N+D DIG + +ER++S D W Sbjct: 493 PVARGVMKFKKARMDF---SENEDEDIGKWESEMTQERELSDYDGW 535 >At5g56250.1 68418.m07019 expressed protein Length = 811 Score = 31.9 bits (69), Expect = 0.11 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 4 PVTEGMMESSREEMTNHVETDNQDADIGVARGDTDKERQISTNDNW 141 PV G+M+ + M ++N+D DIG + +ER++S D W Sbjct: 493 PVARGVMKFKKARMDF---SENEDEDIGKWESEMTQERELSDYDGW 535 >At3g25980.1 68416.m03237 mitotic spindle checkpoint protein, putative (MAD2) identical to Swiss-Prot:Q9LU93 mitotic spindle checkpoint protein MAD2 [Arabidopsis thaliana] Length = 209 Score = 27.9 bits (59), Expect = 1.8 Identities = 17/59 (28%), Positives = 24/59 (40%) Frame = +1 Query: 37 EEMTNHVETDNQDADIGVARGDTDKERQISTNDNWMNKVEATTYAVDLKDEVEFVPIRY 213 E +ETDN+ D GV+R +DKE + TY L + F + Y Sbjct: 99 ERWNFRIETDNEVVDKGVSREKSDKEIMREIQAIMRQVASSVTYLPCLDETCVFDVLAY 157 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 26.6 bits (56), Expect = 4.1 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 25 ESSREEMTNHV-ETDNQDA-DIGVARGDTDKERQISTNDN 138 E S EE+ N V + D++DA D VA D D++ + +DN Sbjct: 116 EESSEELINEVVDYDHEDAGDDAVANEDDDEDAVPNDDDN 155 >At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family protein Length = 592 Score = 26.2 bits (55), Expect = 5.4 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +1 Query: 25 ESSREEMTNHVETDNQDADIGVARGDTDKERQISTNDNWMNKVE 156 ES +EE+ ++ +++ + G G KER+ S D+ + +E Sbjct: 468 ESDKEEIQKKLDGMSKEGNNGKGCGSRAKERKSSNQDSTASSIE 511 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 26.2 bits (55), Expect = 5.4 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 10 TEGMMESSREEMTNHVETDNQDADIGVARGDT-DKERQISTNDNWMNKVEATTYAVDLKD 186 T+ ESS +E T ET+ +D + ++ +T DKE + + ++ E+ + K+ Sbjct: 508 TKEKEESSSQEKTEEKETETKDNEESSSQEETKDKENEKIEKEEASSQEESKENETETKE 567 Query: 187 EVE 195 + E Sbjct: 568 KEE 570 >At4g21460.1 68417.m03104 expressed protein Length = 415 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 67 NQDADIGVARGDTDK---ERQISTNDNWMNKVEATTYAVDLKDE 189 N+DA GV + ++ T+D M K+E+ + D+KDE Sbjct: 90 NEDALPGVIEALLQRRLVDKHAETDDELMEKIESLPFKDDVKDE 133 >At3g14900.1 68416.m01884 expressed protein Length = 611 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 58 ETDNQDADIGVARGDTDKERQISTNDNWMNKVEATTYAVDLKDEVE 195 E DN D D D + E ++ +DN + VE L+DE+E Sbjct: 438 EADNDDDDDDDDDDDGEVE-EVDDDDNMVVDVEGNVEEDSLEDEIE 482 >At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1 [Arabidopsis thaliana] GI:15487382; contains Pfam profile PF00168: C2 domain Length = 589 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 88 VARGDTD-KERQISTNDNWMNKVEATTYAVDLKDEVEFVPIR 210 V G+TD K+ ++ DN ++E++T + +D V+FVP++ Sbjct: 511 VGVGNTDFKQMEMLDADNG-RRLESSTGRIATRDIVQFVPMK 551 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,489,559 Number of Sequences: 28952 Number of extensions: 93645 Number of successful extensions: 324 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 389454624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -