BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D17 (139 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 25 0.25 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 24 0.57 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 22 2.3 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 22 3.0 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 22 3.0 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 22 3.0 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 21 4.0 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 21 4.0 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 21 4.0 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 21 4.0 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 21 4.0 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 21 5.3 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 21 5.3 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 21 5.3 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 21 5.3 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 21 7.0 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 21 7.0 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 21 7.0 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 20 9.3 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 20 9.3 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 20 9.3 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 20 9.3 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 25.4 bits (53), Expect = 0.25 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 15 PKTVAPGRYDPSRYDPGRYEAGRYNPGRXDNSGRY--DPS 128 P PG+ DP+ D G E G+ PG D+ RY DP+ Sbjct: 221 PNYRGPGQRDPNYRDQGFREPGQRFPG--DDRTRYPDDPN 258 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 24.2 bits (50), Expect = 0.57 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 42 DPSRYDPGRYE-AGRYNPGRXD 104 DP R+DP R+ A ++ PG D Sbjct: 116 DPERFDPERFSGANQHPPGPYD 137 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 22.2 bits (45), Expect = 2.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 42 DPSRYDPGRY 71 DP RYDP R+ Sbjct: 412 DPERYDPDRF 421 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 30 PGRYDPSRYDPGRYEA 77 P RYDP R+ P E+ Sbjct: 413 PERYDPDRFAPEACES 428 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 21.8 bits (44), Expect = 3.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 42 DPSRYDPGRYEAGRYN 89 +P R+DP R+ A N Sbjct: 66 EPERFDPERFSAANRN 81 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 21.8 bits (44), Expect = 3.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 42 DPSRYDPGRYEA 77 DP R+DP R+ A Sbjct: 352 DPERFDPDRFTA 363 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 21.8 bits (44), Expect = 3.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 42 DPSRYDPGRYEAG 80 DP R+DP R+ G Sbjct: 107 DPERFDPERFSDG 119 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 42 DPSRYDPGRYEAGR 83 D R+DP R+E R Sbjct: 95 DAERFDPDRFEGAR 108 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 1/15 (6%) Frame = +3 Query: 30 PGRY-DPSRYDPGRY 71 P Y DP R+DP R+ Sbjct: 40 PDHYPDPERFDPDRF 54 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 30 PGRYDPSRYDPGR 68 P YDP R+ P R Sbjct: 424 PATYDPDRFTPER 436 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 30 PGRYDPSRYDPGR 68 P R+DP R+ P R Sbjct: 116 PERFDPERFAPDR 128 Score = 21.0 bits (42), Expect = 5.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 42 DPSRYDPGRYEAGR 83 DP R+DP R+ R Sbjct: 115 DPERFDPERFAPDR 128 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 54 YD-PGRYEAGRYNPGRXDNSGRYDPSS 131 YD P R+ RY+P + + R+ P+S Sbjct: 30 YDLPERFLTSRYSPIGQNLANRFGPNS 56 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 21.0 bits (42), Expect = 5.3 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = -2 Query: 123 GRSDLSCRSVPGCNDRLHNGQGRSGMDRNGQVQQ 22 G SC + P G G G D G+ Q+ Sbjct: 363 GSPSTSCGAPPALLGSGEGGSGTHGTDGGGEFQR 396 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 21.0 bits (42), Expect = 5.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 42 DPSRYDPGRYEAG 80 DP R+DP R+ G Sbjct: 22 DPERFDPERFGDG 34 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 21.0 bits (42), Expect = 5.3 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 30 PGRYDPSRYDPGR 68 P ++DP R+ P R Sbjct: 52 PHQFDPERFSPAR 64 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 21.0 bits (42), Expect = 5.3 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -2 Query: 129 CWGRSDLSCRSVPGCNDRLHNGQGRSGMDRN--GQVQQFWAKP 7 C+G L +PG +D L + G M G + + KP Sbjct: 421 CFGEPPLPALPLPGGDDDLFSPTGNGDMSPTCCGDLSPTFEKP 463 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +3 Query: 18 KTVAPGRYDPSRYDPGRYEAGRY 86 +TV P R+ R P + G Y Sbjct: 283 RTVRPARWTDERSRPRKARGGEY 305 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 20.6 bits (41), Expect = 7.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 42 DPSRYDPGRY 71 DP R+DP R+ Sbjct: 418 DPERFDPDRF 427 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 20.6 bits (41), Expect = 7.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 42 DPSRYDPGRY 71 DP R+DP R+ Sbjct: 118 DPERFDPDRF 127 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 7 RLCPKLLHLAVTIHP 51 RLC LLH A + P Sbjct: 198 RLCSSLLHQAHELRP 212 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 30 PGRYDPSRYDP 62 P R+DP R+ P Sbjct: 408 PERFDPDRFTP 418 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 42 DPSRYDPGRY 71 DP R+DP R+ Sbjct: 443 DPDRFDPERF 452 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 42 DPSRYDPGRY 71 DP R+DP R+ Sbjct: 420 DPERFDPERF 429 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,144 Number of Sequences: 2352 Number of extensions: 2142 Number of successful extensions: 24 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 25 effective length of database: 505,179 effective search space used: 10103580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -