BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D11 (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62170.1 68414.m07013 serpin family protein / serine protease... 40 0.001 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 38 0.005 At1g64030.1 68414.m07252 serpin family protein / serine protease... 35 0.037 At2g14540.1 68415.m01628 serpin family protein / serine protease... 32 0.20 At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containi... 32 0.26 At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 31 0.60 At3g27670.1 68416.m03455 expressed protein 29 2.4 At5g15980.1 68418.m01868 pentatricopeptide (PPR) repeat-containi... 28 3.2 At4g28470.1 68417.m04073 26S proteasome regulatory subunit, puta... 28 4.2 At2g34250.1 68415.m04190 protein transport protein sec61, putati... 28 4.2 At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 28 4.2 At1g29310.1 68414.m03583 protein transport protein sec61, putati... 28 4.2 At2g43340.1 68415.m05389 expressed protein 27 7.4 At1g33050.2 68414.m04070 expressed protein 27 7.4 At1g33050.1 68414.m04069 expressed protein 27 7.4 At3g01220.1 68416.m00028 homeobox-leucine zipper protein, putati... 27 9.8 At1g80200.1 68414.m09386 expressed protein ; expression supporte... 27 9.8 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 27 9.8 At1g64630.1 68414.m07327 protein kinase family protein contains ... 27 9.8 At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase f... 27 9.8 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 39.5 bits (88), Expect = 0.001 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 12/156 (7%) Frame = +3 Query: 72 SDIDPQRVLKNGNDQ--FTARMFNEVVKKNPDKSVILSAFSVMIPLAQLAIASTGESHDE 245 S+ID +K ND F + V KN + + S S+ L +A +S GE +E Sbjct: 60 SNIDVGEAMKKQNDVAIFLTGIVISSVAKN--SNFVFSPASINAALTMVAASSGGEQGEE 117 Query: 246 LLKAI-DFPNDNVTKAVFTDLNQKVRSIKGVD--LKLANKVYIANGNELNDQFAV--VSR 410 L I F + T + + +++ S+ VD K K+ + NG ++ +V +S+ Sbjct: 118 LRSFILSFLKSSSTDEL-NAIFREIASVVLVDGSKKGGPKIAVVNGMWMDQSLSVNPLSK 176 Query: 411 DVF----NSEVQNLNF-GKNEEAANIINTWVEDHTN 503 D+F ++ ++F K EE +N W HTN Sbjct: 177 DLFKNFFSAAFAQVDFRSKAEEVRTEVNAWASSHTN 212 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 37.5 bits (83), Expect = 0.005 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 6/119 (5%) Frame = +3 Query: 165 SVILSAFSVMIPLAQLAIASTGESHDELLKAI-----DFPNDNVTKAVFTDLNQKVRSIK 329 +++ S S+ + L +A S + +++L I D+ N + K V LN + Sbjct: 30 NLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLPSSDYLNAVLAKTVSVALNDGMER-S 88 Query: 330 GVDLKLANKVYIANGNELNDQFAVVSRDVFNSEVQNLNFG-KNEEAANIINTWVEDHTN 503 + L A V+I F + + +N+ ++F K E N +N W E HTN Sbjct: 89 DLHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFATKPAEVINEVNAWAEVHTN 147 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 34.7 bits (76), Expect = 0.037 Identities = 35/152 (23%), Positives = 65/152 (42%), Gaps = 7/152 (4%) Frame = +3 Query: 78 IDPQRVLKNGNDQFTARMFNEVVKKNP-DKSVILSAFSVMIPLAQLAIASTGES-HDELL 251 +D + +KN + V+ P D +VI S S+ + A G+ ++L Sbjct: 1 MDVREAMKN-QTHVAMILSGHVLSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQIL 59 Query: 252 KAIDFPNDNVTKAVFTDLNQKVRSIK----GVDLKLANKVYIANGNELNDQFAVVSRDVF 419 + + + K VF +L V + + G + AN ++I + +F + + F Sbjct: 60 SFLRSSSIDELKTVFRELASVVYADRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFF 119 Query: 420 NSEVQNLNF-GKNEEAANIINTWVEDHTNKRI 512 + ++F + EE +N+WVE HTN I Sbjct: 120 KAVYVPVDFRSEAEEVRKEVNSWVEHHTNNLI 151 >At2g14540.1 68415.m01628 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 407 Score = 32.3 bits (70), Expect = 0.20 Identities = 32/151 (21%), Positives = 58/151 (38%), Gaps = 6/151 (3%) Frame = +3 Query: 78 IDPQRVLKNGNDQFTARMFNEVVKKNPDKSVILSAFSVMIPLAQLAIASTGES-HDELLK 254 ID Q +KN N+ + + + + + S S+ L A + ++ +L Sbjct: 29 IDMQEAMKNQNEVSLLLVGKVISAVAKNSNCVFSPASINAVLTVTAANTDNKTLRSFILS 88 Query: 255 AIDFPNDNVTKAVFTDLNQKV----RSIKGVDLKLANKVYIANGNELNDQFAVVSRDVFN 422 + + T A+F +L V G + N V++ N + + + F Sbjct: 89 FLKSSSTEETNAIFHELASVVFKDGSETGGPKIAAVNGVWMEQSLSCNPDWEDLFLNFFK 148 Query: 423 SEVQNLNFG-KNEEAANIINTWVEDHTNKRI 512 + ++F K EE +NTW HTN I Sbjct: 149 ASFAKVDFRHKAEEVRLDVNTWASRHTNDLI 179 >At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 939 Score = 31.9 bits (69), Expect = 0.26 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 114 QFTARMFNEVVKKNPDKSVILSAFSVMIPLAQLAIASTGE-SHDELLKAIDFPNDNVTKA 290 Q +F E++ + K ++ SV ++ L G+ +HD L + PNDN+T A Sbjct: 673 QLALHLFREMISSSQVKPDAITMVSVFSAISSLGSLEEGKRAHDYLNFSTIPPNDNLTAA 732 Query: 291 VFTDLNQKVRSIK 329 + D+ K SI+ Sbjct: 733 II-DMYAKCGSIE 744 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 30.7 bits (66), Expect = 0.60 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 339 LKLANKVYIANGNELNDQFAVVSRDVFNSEVQNLNFG-KNEEAANIINTWVEDHTN 503 L +AN V+I L F + + + + ++F K E + +NTW E HTN Sbjct: 27 LSIANGVWIDKFFSLKLSFKDLLENSYKATCSQVDFASKPSEVIDEVNTWAEVHTN 82 >At3g27670.1 68416.m03455 expressed protein Length = 1841 Score = 28.7 bits (61), Expect = 2.4 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = -2 Query: 478 LIMLAASSFLPKFKFCTSELNTSLDTTAN*SFNSLPLAMYTLLASLRSTPL-IDLTF*FK 302 L +L FL K+K T N S+ A S SL L T L S S + + + Sbjct: 324 LCILKFLLFLLKWK--TESENLSVKDAAGSSVESLLLFPITALMSSPSKSIKVAASKVLS 381 Query: 301 SVNTALVTLSLGKSIALRSSSCDSPVEAIAS 209 V LVT+S I + +S DSP+ + S Sbjct: 382 IVENFLVTVSNAPKIEVHTSKGDSPLSRVGS 412 >At5g15980.1 68418.m01868 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 668 Score = 28.3 bits (60), Expect = 3.2 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 5/100 (5%) Frame = +3 Query: 105 GNDQFTARMFNEVVK-KNPDKSVILSAF-SVMIPLAQLAIASTGESHDELLKAIDFPNDN 278 G ++F R N VV+ ++ V + + V Q + E+ A ++N Sbjct: 298 GKEKFLDRFQNIVVEMRSAGYEVEIETYVRVSTRFCQTKLIKEAVDLFEIAMAGSSSSNN 357 Query: 279 VTKAVFTDLNQKVRSIKGVDLKL---ANKVYIANGNELND 389 T F L +K+ + K +D+ L A KVY NGN L D Sbjct: 358 PTPHCFCLLLKKIVTAKILDMDLFSRAVKVYTKNGNALTD 397 >At4g28470.1 68417.m04073 26S proteasome regulatory subunit, putative contains Pfam domain PF01851: Proteasome/cyclosome repeat Length = 1103 Score = 27.9 bits (59), Expect = 4.2 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 282 TKAVFTDLNQKVRSIKGVDLKLANKVYIANGNEL--NDQFAVVSRDVFNSEVQNL 440 T V N+K+R K D+ L + Y GN L +DQF++ + + +VQ+L Sbjct: 637 TAEVSKTFNEKIR--KYCDMTLLSCAYAGTGNVLKVSDQFSLTLQTIQTIQVQDL 689 >At2g34250.1 68415.m04190 protein transport protein sec61, putative similar to PfSec61 [Plasmodium falciparum] GI:3057044; contains Pfam profile PF00344: eubacterial secY protein Length = 475 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 428 FRIKHISGHNSKLII*FITVSNVYFISQFEINSFNRSYFL 309 + IK N +I+ VSN+YFISQ F+ ++F+ Sbjct: 282 YPIKLFYTSNMPIILQSALVSNLYFISQLLYRKFSGNFFV 321 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +3 Query: 375 NELNDQFAVVSRDVFNSEVQNLNFGKNEEAANIINTWVEDHTN 503 NE + +R V + +V L+ +N+ ++I W +DH N Sbjct: 691 NESCESVFSSARSVLSDDVDELSNSENDFGDDLILEWAKDHNN 733 >At1g29310.1 68414.m03583 protein transport protein sec61, putative similar to PfSec61 [Plasmodium falciparum] GI:3057044; contains Pfam profile PF00344: eubacterial secY protein Length = 475 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 428 FRIKHISGHNSKLII*FITVSNVYFISQFEINSFNRSYFL 309 + IK N +I+ VSN+YFISQ F+ ++F+ Sbjct: 282 YPIKLFYTSNMPIILQSALVSNLYFISQLLYRKFSGNFFV 321 >At2g43340.1 68415.m05389 expressed protein Length = 189 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 250 RSSSCDSPVEAIASWANGIMTENADNI 170 +SS DSPV IASW +N D++ Sbjct: 144 KSSVLDSPVSPIASWKISSPGDNPDDV 170 >At1g33050.2 68414.m04070 expressed protein Length = 607 Score = 27.1 bits (57), Expect = 7.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 345 LANKVYIANGNELNDQFAVVSRDVFNSEVQNLN 443 L+ + +A+G+E +D D+ NS VQNLN Sbjct: 529 LSELLTLAHGSESSDSPNAEELDLINSTVQNLN 561 >At1g33050.1 68414.m04069 expressed protein Length = 693 Score = 27.1 bits (57), Expect = 7.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 345 LANKVYIANGNELNDQFAVVSRDVFNSEVQNLN 443 L+ + +A+G+E +D D+ NS VQNLN Sbjct: 529 LSELLTLAHGSESSDSPNAEELDLINSTVQNLN 561 >At3g01220.1 68416.m00028 homeobox-leucine zipper protein, putative / HD-ZIP transcription factor, putative similar to homeobox-leucine zipper protein, HAT7 (GB:Q00466) [Arabidopsis thaliana] Length = 286 Score = 26.6 bits (56), Expect = 9.8 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -2 Query: 304 KSVNTALVTLS---LGKSIALRSSSCDS----PVEAIASWANGIMTENADNI 170 KS N +L+ + L + +AL++ C+ EA ASW+N TEN+ +I Sbjct: 159 KSDNASLLAYNKKLLAEVMALKNKECNEGNIVKREAEASWSNNGSTENSSDI 210 >At1g80200.1 68414.m09386 expressed protein ; expression supported by MPSS Length = 234 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -2 Query: 292 TALVTLSLGKSIALRSSSCDSPVEAIAS 209 T + L + + +A R+ SC++P+E I+S Sbjct: 51 TDSILLGIEEIVACRNKSCETPLEVISS 78 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 26.6 bits (56), Expect = 9.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 107 SILEYSLWVDVTGQCQGREGKYGYY 33 S ++Y W+D GQ +EG G++ Sbjct: 284 STIKYKGWLDAVGQIWRKEGPQGFF 308 >At1g64630.1 68414.m07327 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719; contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 524 Score = 26.6 bits (56), Expect = 9.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 411 DVFNSEVQNLNFGKNEEAANIINTWVEDHTNKRI 512 D SEV LN K++ + +WV+DH NK I Sbjct: 60 DRLYSEVHLLNSLKHDNIIKLFYSWVDDH-NKSI 92 >At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 892 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 363 IANGNELNDQFAVVSRDVFNSEVQNLNFGKNEE 461 ++NG+ +F+ R+ F +V + FGK E+ Sbjct: 265 LSNGHSNGFKFSFFGRNTFKDDVSSRTFGKGEK 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,532,637 Number of Sequences: 28952 Number of extensions: 170613 Number of successful extensions: 485 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -