BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D10 (534 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36923| Best HMM Match : FlaC_arch (HMM E-Value=0.34) 31 0.45 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 31 0.78 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) 30 1.0 SB_27463| Best HMM Match : C_tripleX (HMM E-Value=0.11) 30 1.0 SB_51503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 30 1.4 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) 29 1.8 SB_58912| Best HMM Match : rve (HMM E-Value=2.2e-17) 29 2.4 SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) 29 2.4 SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) 29 2.4 SB_28953| Best HMM Match : rve (HMM E-Value=8.9e-07) 29 2.4 SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) 29 2.4 SB_2133| Best HMM Match : rve (HMM E-Value=2.2e-17) 29 2.4 SB_41308| Best HMM Match : rve (HMM E-Value=6e-12) 29 2.4 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 29 2.4 SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 29 3.2 SB_54607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_32270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_53131| Best HMM Match : MbeB_N (HMM E-Value=2) 28 4.2 SB_45179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_12579| Best HMM Match : zf-C2H2 (HMM E-Value=5.4e-28) 28 4.2 SB_2987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_2115| Best HMM Match : rve (HMM E-Value=0.091) 28 4.2 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) 28 5.5 SB_41087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_36596| Best HMM Match : PSP (HMM E-Value=3.3e-18) 28 5.5 SB_35149| Best HMM Match : DUF1172 (HMM E-Value=0.19) 28 5.5 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_13706| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_52889| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) 27 7.3 SB_51727| Best HMM Match : RasGEF_N (HMM E-Value=7.8) 27 7.3 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 7.3 SB_26014| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) 27 7.3 SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_13408| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_3702| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_12630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_36923| Best HMM Match : FlaC_arch (HMM E-Value=0.34) Length = 240 Score = 31.5 bits (68), Expect = 0.45 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 68 DSGIISAGREGESIPFISWSDPEPFPVNFVGVCTG 172 D G + G E I F+ WS + F N VCTG Sbjct: 200 DKGNVKMGNELSDISFVLWSVEQEFASNAGAVCTG 234 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 30.7 bits (66), Expect = 0.78 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 209 PSAPVAAPLYSAPPGYPGVQAHPGGGAG 292 P+ P P PPG PG Q PG AG Sbjct: 59 PNGPKGPPGLPGPPGPPGFQGPPGNPAG 86 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 30.7 bits (66), Expect = 0.78 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = -1 Query: 234 SGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQRTQ 55 S TG S+ +EP + +P+ + K T + D D RPA+ P + ++ Sbjct: 78 SAVDTGPKAKDSVTKEPASAKPLKSWQKSTSPEANKDSD----SESRRPANPRPFALSSK 133 Query: 54 KPRN 43 KPR+ Sbjct: 134 KPRS 137 >SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) Length = 530 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 215 APVAAPLYSAPPGYPGVQA 271 +P A+P Y PP YPG QA Sbjct: 49 SPQASPAYQPPPAYPGYQA 67 >SB_27463| Best HMM Match : C_tripleX (HMM E-Value=0.11) Length = 123 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 215 APVAAPLYSAPPGYPGVQA 271 +P A+P Y PP YPG QA Sbjct: 78 SPQASPAYQPPPAYPGYQA 96 >SB_51503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 209 PSAPVAAPLYSAPPGYPGVQAHPGGG 286 P+ P P + PG+PG+ A PG G Sbjct: 122 PTGPAGDPGMTGVPGFPGINAIPGEG 147 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +2 Query: 206 QPSAPVAAPLYSAPP--GYPGVQAHP 277 Q AP + Y APP GYPG Q HP Sbjct: 86 QYGAPPTSQPYGAPPTSGYPGYQQHP 111 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 320 PGHLKRLPRCQHHHQDALEHQGNQAGRCTVEQP 222 P H+K+ P HH D+ GNQA +P Sbjct: 815 PPHMKKSPFVVHHPPDSASRHGNQAPEAHHHEP 847 >SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1013 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 451 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 503 Query: 60 TQKPR 46 +P+ Sbjct: 504 ASEPK 508 >SB_58912| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 511 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 421 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 473 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 474 ASEP-VSPA 481 >SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) Length = 361 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 271 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 323 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 324 ASEP-VSPA 331 >SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1017 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 927 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 979 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 980 ASEP-VSPA 987 >SB_28953| Best HMM Match : rve (HMM E-Value=8.9e-07) Length = 555 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 465 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 517 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 518 ASEP-VSPA 525 >SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1229 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 1139 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 1191 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 1192 ASEP-VSPA 1199 >SB_2133| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 425 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 335 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 387 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 388 ASEP-VSPA 395 >SB_41308| Best HMM Match : rve (HMM E-Value=6e-12) Length = 581 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 491 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 543 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 544 ASEP-VSPA 551 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -2 Query: 359 QNNLALRLLHPVGPGHLKRLPRCQHHHQDALEHQGNQAGRCTVEQPLER 213 Q+ A++L G G H+HQ E+ +C +EQP ++ Sbjct: 151 QSEGAVQLNCSEGVGRSDHTGSVSHNHQSGCENDSQSCDKCQIEQPEDK 199 >SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 192 QEPVAPQPVHTPTKLTGKGSGSDQD 118 Q+P A +P TP +TG SGSD D Sbjct: 401 QKPPATRPSATPPPVTGDESGSDYD 425 >SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 1163 Score = 28.7 bits (61), Expect = 3.2 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 1073 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 1125 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 1126 APEP-VSPA 1133 >SB_54607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 258 LVFKRILVVVLASGQTLQVARSHRVQ*SEGKIVLENHCTLPERNTRAQLCQENW 419 + F R+++++LA T +AR +V+ GK L RN ++C ++W Sbjct: 1 MAFVRVVLLILAVLPTYGLARWMQVRLKNGKEPHMGMVELRYRNKWGEICDQDW 54 >SB_32270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 28.7 bits (61), Expect = 3.2 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+G+ G D+P+RP + P S Sbjct: 195 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGTGT----TGSDTPTRPPETEPGSAE 247 Query: 60 TQKP 49 +P Sbjct: 248 ASEP 251 >SB_53131| Best HMM Match : MbeB_N (HMM E-Value=2) Length = 374 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -1 Query: 207 CTS---IFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQRTQKPRN 43 CTS +F +P H+ + + +GSG D D + +D + +D + Q N Sbjct: 5 CTSLAVVFHYRASPSSSHSQSSGSPEGSGDDDDQDDVDLSTNSSDSGEVPPHVQDAMN 62 >SB_45179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 29 LNAGEFRGFWVRWDSGIISAGREGESIPFISWSDPEPFPVNFVGVCTGWGAT 184 + GEF +W+R + +IS G + I + P ++VGV W A+ Sbjct: 144 IKEGEFETYWMRISNVLISLGGNKDEID--NLKTKRPATRDYVGVLQQWRAS 193 >SB_12579| Best HMM Match : zf-C2H2 (HMM E-Value=5.4e-28) Length = 400 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 284 HHQDALEHQGNQAGRCTVEQPLERTVA 204 HHQD++ H G AG + L T+A Sbjct: 106 HHQDSMSHLGTSAGLTSHSLALHETIA 132 >SB_2987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -1 Query: 207 CTS---IFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQRTQKPRN 43 CTS +F +P H+ + + +GSG D D + +D + +D + Q N Sbjct: 5 CTSLAVVFHYRASPSSSHSQSSGSPEGSGDDDDQDDVDLSTNSSDSGEVPPHVQDAMN 62 >SB_2115| Best HMM Match : rve (HMM E-Value=0.091) Length = 345 Score = 28.3 bits (60), Expect = 4.2 Identities = 24/69 (34%), Positives = 33/69 (47%) Frame = -1 Query: 240 LYSGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQR 61 L G AT + S+ + P P P T+ TG G+ D G D+P+RP + P S Sbjct: 255 LPKGTATTSPTGISV-ETPTRPSP--PLTRDTGPGT----DTTGSDTPTRPPETEPGSAE 307 Query: 60 TQKPRNSPA 34 +P SPA Sbjct: 308 ASEP-VSPA 315 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 206 QPSAPVAAPLYSAPPGYPGVQAHPGGGAG 292 QPS+P AP+ P + PGG AG Sbjct: 1880 QPSSPARAPINRVPAMSDSIAKLPGGAAG 1908 >SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) Length = 287 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 114 SYPGRIPNPSPLTSLAYV 167 S P R P+PSPLTS+ Y+ Sbjct: 208 SAPVRAPSPSPLTSIYYI 225 >SB_41087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/43 (34%), Positives = 27/43 (62%) Frame = +3 Query: 171 AGALPVLGKSKCNRPLQWLLHCTAPRLVTLVFKRILVVVLASG 299 +GALP+ +R +Q+++H + R+ T KRI +VL++G Sbjct: 420 SGALPLYNADTSSRIIQFIIHNSTRRIET-AEKRIDSLVLSAG 461 >SB_36596| Best HMM Match : PSP (HMM E-Value=3.3e-18) Length = 855 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 87 LVARVNQSHSYPGRIPNPSPLTSL 158 L+ R++Q H P P+PSP T L Sbjct: 671 LIKRLHQKHHLPAVTPSPSPNTEL 694 >SB_35149| Best HMM Match : DUF1172 (HMM E-Value=0.19) Length = 1150 Score = 27.9 bits (59), Expect = 5.5 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = -1 Query: 177 PQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQRTQKPRNSPAFKIEGVSISTL 1 P + +PT +T S+ D+ IDS ++ T+ N PA I G I TL Sbjct: 337 PSNLASPTSVTASFDSSNDDVMDIDSSD--WSVLSDDGNTEASTNQPAVSIGGDPIVTL 393 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.5 bits (58), Expect = 7.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -2 Query: 365 VLQNNLALRLLHPVGPGHLKRLPRCQHHHQDALEHQGNQAGRCT 234 VL NN + L P G +K + RC+ H+ E G RCT Sbjct: 743 VLSNNSCINLC-PSGTFLVKGIHRCRPCHESCAECTGAGHDRCT 785 >SB_13706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 27.5 bits (58), Expect = 7.3 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -1 Query: 201 SIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPAD 82 ++F P+ +P TG+ GSD D +G D D Sbjct: 312 NVFSIPIYVKPSEYVQPYTGRNCGSDDDHDGDDEDDHDGD 351 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 209 PSAPVAAPLYSAPPGYPGVQAHPGGGAGIWAD 304 P+AP A P P P A P GG G AD Sbjct: 187 PAAPPAPPFGGPPSAPPPPPAPPVGGGGSLAD 218 >SB_52889| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) Length = 623 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 138 PSPLTSLAYVPAGALPVLG---KSKCNRPLQWLLHCTAPRLVTLVF 266 PSP+++ Y + +PVLG S+C P+ +L T +L+F Sbjct: 147 PSPISTYNYTNSEEIPVLGLEAYSRCKPPISRVLLFTLTVFFSLLF 192 >SB_51727| Best HMM Match : RasGEF_N (HMM E-Value=7.8) Length = 243 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 322 PTGCSSRRARLFWRTIVRCQSA 387 P GC+SRR + R I RC A Sbjct: 122 PEGCASRRRKRLTRCIYRCSGA 143 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 27.5 bits (58), Expect = 7.3 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 268 LNTRVTRRGAVQWSSHWSGRLHFDFPRTGSAPAGTYANEVNGE--GFGIRPGYEWD 107 L R R AV W SH S R+ RT P T NG I+ EWD Sbjct: 2039 LVARYVRFVAVSWRSHISMRVELYGKRTVRRPRPTSCGIGNGRLPNRNIKASSEWD 2094 >SB_26014| Best HMM Match : Pex2_Pex12 (HMM E-Value=1) Length = 578 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 138 PSPLTSLAYVPAGALPVLG---KSKCNRPLQWLLHCTAPRLVTLVF 266 PSP+++ Y + +PVLG S+C P+ +L T +L+F Sbjct: 204 PSPISTYNYTNSEEIPVLGLEAYSRCKPPISRVLLFTLTVFFSLLF 249 >SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 972 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = -1 Query: 192 QEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSP---SRPADIMPLSQRTQKPRNSPAFKIE 22 Q + PQ H P + G+ + M + SP + P + + Q+ + P N P E Sbjct: 479 QGSLQPQGTHYPQGVAVSGASASGQMM-MQSPYMGTSPQPVYVMQQQARPPFNQPQMGSE 537 Query: 21 GVSIS 7 GV S Sbjct: 538 GVGSS 542 >SB_13408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -2 Query: 512 PSC*GHLRESGN*VCHVQDHPMVYRHIRAMAPIFLAELRPRVALW 378 P GH++ + + H+Q+ P V HI+ P+ + ++ A+W Sbjct: 121 PPVIGHIQNTPPVIGHIQNTPPVIGHIQNTPPV-IGHIQNTPAIW 164 >SB_3702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = +2 Query: 236 YSAPP-GYPGVQAHP 277 YS PP GYPGVQ +P Sbjct: 14 YSQPPQGYPGVQTYP 28 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 27.1 bits (57), Expect = 9.6 Identities = 28/88 (31%), Positives = 38/88 (43%), Gaps = 6/88 (6%) Frame = -3 Query: 517 GHPVVRATYENLVIRFAMFKTTPWY---IGTSVRWHQFS--WQSC-ALVLRSGNVQWFSR 356 G PV+ T + +R + + PW I S WHQFS W L + + N S Sbjct: 265 GAPVLFYTVKYRTVRGTLGRG-PWVPRNISVSSTWHQFSLDWDKVYELSVTAWNKYGESV 323 Query: 355 TILPSDYCTRWDLAT*SVCPDASTTTRM 272 T L D C + T P A+TTT + Sbjct: 324 TDLELDTC----VVTVGADPSAATTTAL 347 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 189 EPVAPQPVHTPTKLTGKGSGSDQD--MNGIDSPSRPADIMP 73 +P AP P T G +G+D D D+ S P+D MP Sbjct: 984 DPPAPPPSATSAADAGLTAGTDSDAAAEAEDTSSHPSDKMP 1024 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 5/66 (7%) Frame = -1 Query: 186 PVAPQPVHTPTKLTGKGSGSDQDMN----GIDSPSRPADIMPLSQRTQKPRNSP-AFKIE 22 P+ P+P +K +GSGS+ + + GI S + P ++ + QK N I Sbjct: 1535 PIKPKPPIPSSKPARRGSGSNNNSDDAGVGIYSEASPTRNNEINYQRQKETNPDIPLSIG 1594 Query: 21 GVSIST 4 G SI T Sbjct: 1595 GASIDT 1600 >SB_12630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.1 bits (57), Expect = 9.6 Identities = 23/67 (34%), Positives = 31/67 (46%) Frame = -1 Query: 234 SGAATGADGCTSIFQEPVAPQPVHTPTKLTGKGSGSDQDMNGIDSPSRPADIMPLSQRTQ 55 S A T G + + P P P T TG G+G+ G D+P+RP + P S Sbjct: 931 STATTSPTGIS--VETPTRPSP--PLTIYTGPGTGT----TGSDTPTRPPETEPGSAEAS 982 Query: 54 KPRNSPA 34 +P SPA Sbjct: 983 EP-VSPA 988 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,584,754 Number of Sequences: 59808 Number of extensions: 516025 Number of successful extensions: 1732 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 1530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1724 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -