BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D07 (540 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0033 + 27820563-27823482,27823593-27823996 30 1.4 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 28 4.1 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 5.5 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 7.2 11_01_0398 - 3008074-3008428,3009775-3009926,3010070-3011368 27 9.6 04_04_1392 + 33201015-33201600,33202030-33202406,33202528-332026... 27 9.6 01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187... 27 9.6 >11_08_0033 + 27820563-27823482,27823593-27823996 Length = 1107 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 49 GVTENVSLQDKRCRRSVCGAPEKGFIPFP 135 GV N++L+ R +CG+P G +P P Sbjct: 709 GVFSNITLKSLRGNAGLCGSPRLGLLPCP 737 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 347 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAV 442 Y KD FY + + + EG+FL ++Y+ + Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQI 728 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -3 Query: 394 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 248 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 372 TRVPLSL-VCT*MRDSSCTHIILQLSSAMILMDSFYQLLMK 491 T+ P S V T + S+CTH QLSSA +L + +K Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLLSSQLKEKELK 105 >11_01_0398 - 3008074-3008428,3009775-3009926,3010070-3011368 Length = 601 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 7 PSSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAPEKGFIPFPRCRPS 150 PS + A + Q GV +VSL+ ++ + +K + PF C PS Sbjct: 296 PSPTKAQSRGSPQLGVPLHVSLKTCSHPQNASSSGQKKYTPFEECYPS 343 >04_04_1392 + 33201015-33201600,33202030-33202406,33202528-33202638, 33202720-33202815,33202899-33203570 Length = 613 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 322 SLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 206 S FP + E GE+ V GK+ D + SF + V ++ Sbjct: 500 SKFPSAISESGEITVEGKVKDGIPHLTKVGSFQVDVSLE 538 >01_06_0006 - 25517892-25517935,25518156-25518276,25518598-25518733, 25519189-25519280,25519358-25519426,25519710-25519821, 25519897-25520015,25520302-25520355,25520811-25520891, 25520968-25521051,25521124-25521315,25521633-25521746, 25521832-25521978,25522066-25522302,25522762-25522810, 25522894-25523027,25523124-25523324,25523532-25523701, 25523773-25523875,25524198-25524361,25525015-25525055, 25525144-25525187 Length = 835 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +2 Query: 86 VDAVFVERQKKVLSLFQDVDQVNVDDEYYK-------IGKDYDVEANIDNYTNKKAVEEF 244 VD V+ Q+K + +++ + +++ Y+ I K E + Y NK +EF Sbjct: 651 VDRVYRIGQEKNVIIYRLITSCTIEERIYEKQVSKEGIFKAATEERDFRRYINKLGYKEF 710 Query: 245 LKLYRIGY 268 LKL +G+ Sbjct: 711 LKLPEMGF 718 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,611,959 Number of Sequences: 37544 Number of extensions: 263156 Number of successful extensions: 610 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -